Recombinant Human CD274 Protein, His&T7-tagged

Cat.No. : CD274-6778H
Product Overview : Recombinant human CD274 extracellular domain cDNA (19-238 aa, derived from BC074984) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal and expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 19-238 a.a.
Form : Liquid
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Purity : > 90% by SDS-PAGE
Usage : Standard coating was performed using 1ml PBS / well, which contains 5-10 ug protein / well) for incubating at 4°C overnight. After coating, remove PBS solution, the plate is ready for cell culture study.
Storage : Keep at -20 centigrade for long term storage. Product is stableat 4 centigrade for at least 30 days.
Concentration : 0.5 mg/mL
Storage Buffer : 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
Gene Name CD274 CD274 molecule [ Homo sapiens (human) ]
Official Symbol CD274
Synonyms CD274; CD274 molecule; B7-H; B7H1; PDL1; PD-L1; hPD-L1; PDCD1L1; PDCD1LG1; programmed cell death 1 ligand 1; B7 homolog 1; CD274 antigen; PDCD1 ligand 1
Gene ID 29126
mRNA Refseq NM_014143
Protein Refseq NP_054862
MIM 605402
UniProt ID Q9NZQ7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD274 Products

Required fields are marked with *

My Review for All CD274 Products

Required fields are marked with *

0
cart-icon
0
compare icon