Recombinant Human CD274 Protein, His&T7-tagged
Cat.No. : | CD274-6778H |
Product Overview : | Recombinant human CD274 extracellular domain cDNA (19-238 aa, derived from BC074984) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal and expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 19-238 a.a. |
Form : | Liquid |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER |
Purity : | > 90% by SDS-PAGE |
Usage : | Standard coating was performed using 1ml PBS / well, which contains 5-10 ug protein / well) for incubating at 4°C overnight. After coating, remove PBS solution, the plate is ready for cell culture study. |
Storage : | Keep at -20 centigrade for long term storage. Product is stableat 4 centigrade for at least 30 days. |
Concentration : | 0.5 mg/mL |
Storage Buffer : | 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
Gene Name | CD274 CD274 molecule [ Homo sapiens (human) ] |
Official Symbol | CD274 |
Synonyms | CD274; CD274 molecule; B7-H; B7H1; PDL1; PD-L1; hPD-L1; PDCD1L1; PDCD1LG1; programmed cell death 1 ligand 1; B7 homolog 1; CD274 antigen; PDCD1 ligand 1 |
Gene ID | 29126 |
mRNA Refseq | NM_014143 |
Protein Refseq | NP_054862 |
MIM | 605402 |
UniProt ID | Q9NZQ7 |
◆ Native Proteins | ||
CD274-77M | Active Recombinant Mouse CD274 Protein, Fctagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD274-2642MCL | Recombinant Mouse CD274 cell lysate | +Inquiry |
CD274-002RCL | Recombinant Rat CD274 cell lysate | +Inquiry |
CD274-2735HCL | Recombinant Human CD274 cell lysate | +Inquiry |
CD274-914CCL | Recombinant Cynomolgus CD274 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD274 Products
Required fields are marked with *
My Review for All CD274 Products
Required fields are marked with *