Species : |
Human |
Tag : |
Fc |
Description : |
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. |
Conjugation : |
Fc |
Tissue specificity : |
B-cells and in primary carcinomas. |
Biological activity : |
Activity:The ED50 of CD40-27810TH is typically 1.0-1.5 ug/ml as measured by its ability to neutralize CD40 ligand mediated proliferation of T47-D cells. |
Form : |
Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not rec |
Purity : |
>95% by SDS-PAGE |
Storage buffer : |
Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin, PBS |
Storage : |
Store at +4°C. |
Sequences of amino acids : |
Theoretical Sequence:EPPTACREKQYLINSQCCSLCQPGQKLVS DCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNL GLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSC SPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWT SCETKDLVVQQAGTNKTDVVCGPQDRLRRSSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K |
Sequence Similarities : |
Contains 4 TNFR-Cys repeats. |
Full Length : |
Full L. |