Recombinant Human CD55 Protein, GST-tagged
Cat.No. : | CD55-2325H |
Product Overview : | Human DAF full-length ORF ( NP_000565.1, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a glycoprotein involved in the regulation of the complement cascade. Binding of the encoded protein to complement proteins accelerates their decay, thereby disrupting the cascade and preventing damage to host cells. Antigens present on this protein constitute the Cromer blood group system (CROM). Alternative splicing results in multiple transcript variants. The predominant transcript variant encodes a membrane-bound protein, but alternatively spliced transcripts may produce soluble proteins. [provided by RefSeq, Jul 2014] |
Molecular Mass : | 67.8 kDa |
AA Sequence : | MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLSGHTCFTLTGLLGTLVTMGLLT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) [ Homo sapiens ] |
Official Symbol | CD55 |
Synonyms | CD55; CD55 molecule, decay accelerating factor for complement (Cromer blood group); DAF, decay accelerating factor for complement (CD55, Cromer blood group system); complement decay-accelerating factor; CR; CROM; TC; CD55 antigen; DAF; |
Gene ID | 1604 |
mRNA Refseq | NM_000574 |
Protein Refseq | NP_000565 |
MIM | 125240 |
UniProt ID | P08174 |
◆ Recombinant Proteins | ||
CD55-64HAF488 | Recombinant Human CD55 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
CD55-689H | Recombinant Human CD55 Protein, His-tagged | +Inquiry |
CD55-64HP | Recombinant Human CD55 protein, Fc-tagged, R-PE labeled | +Inquiry |
CD55-01H | Recombinant Human CD55 Protein (35-353aa), C-His-tagged | +Inquiry |
CD55-151H | Recombinant Human CD55 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD55-2531HCL | Recombinant Human CD55 cell lysate | +Inquiry |
CD55-1669MCL | Recombinant Mouse CD55 cell lysate | +Inquiry |
CD55-1433RCL | Recombinant Rat CD55 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD55 Products
Required fields are marked with *
My Review for All CD55 Products
Required fields are marked with *
0
Inquiry Basket