Recombinant Human CD55 protein, His-tagged
| Cat.No. : | CD55-3161H |
| Product Overview : | Recombinant Human CD55 protein(35-126 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 02, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 35-126 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVE |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CD55 CD55 molecule, decay accelerating factor for complement (Cromer blood group) [ Homo sapiens ] |
| Official Symbol | CD55 |
| Synonyms | CD55; CD55 molecule, decay accelerating factor for complement (Cromer blood group); DAF, decay accelerating factor for complement (CD55, Cromer blood group system); complement decay-accelerating factor; CR; CROM; TC; CD55 antigen; DAF; |
| Gene ID | 1604 |
| mRNA Refseq | NM_000574 |
| Protein Refseq | NP_000565 |
| MIM | 125240 |
| UniProt ID | P08174 |
| ◆ Recombinant Proteins | ||
| CD55-64HF | Recombinant Human CD55 Protein, Fc-tagged, FITC conjugated | +Inquiry |
| Cd55-696R | Recombinant Rat Cd55 Protein, His-tagged | +Inquiry |
| CD55-151H | Recombinant Human CD55 Protein, His-tagged | +Inquiry |
| CD55-64HAF647 | Recombinant Human CD55 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| CD55-65H | Recombinant Human CD55 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD55-1433RCL | Recombinant Rat CD55 cell lysate | +Inquiry |
| CD55-2531HCL | Recombinant Human CD55 cell lysate | +Inquiry |
| CD55-1669MCL | Recombinant Mouse CD55 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD55 Products
Required fields are marked with *
My Review for All CD55 Products
Required fields are marked with *
