Recombinant Human CD59 Protein
| Cat.No. : | CD59-6744H |
| Product Overview : | Recombinant Human CD59 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Form : | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.0, with 1 mM DTT, 5 % trehalose. |
| Molecular Mass : | Approximately 9.0 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids. |
| AASequence : | LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN |
| Endotoxin : | Less than 0.1 EU/μg of rHuCD59 as determined by LAL method. |
| Purity : | > 97 % by SDS-PAGE analyses. |
| Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. - 12 months from date of receipt, -20 to -70 °C as supplied. - 1 month, 2 to 8 °C under sterile conditions after reconstitution. - 3 months, -20 to -70 °C under sterile conditions after reconstitution. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
| Gene Name | CD59 CD59 molecule, complement regulatory protein [ Homo sapiens ] |
| Official Symbol | CD59 |
| Synonyms | CD59; CD59 molecule, complement regulatory protein; CD59 antigen p18 20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344) , CD59 antigen, complement regulatory protein , MIC11, MIN1, MIN2, MIN3, MSK21; CD59 glycoprotein; 16.3A5; EJ16; EJ30; EL32; G344; p18 20; protectin; 1F5 antigen; MEM43 antigen; Ly-6-like protein; T cell-activating protein; human leukocyte antigen MIC11; lymphocytic antigen CD59/MEM43; 20 kDa homologous restriction factor; membrane inhibitor of reactive lysis; membrane attack complex inhibition factor; membrane attack complex (MAC) inhibition factor; surface anitgen recognized by monoclonal 16.3A5; CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344); 1F5; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; HRF-20; MAC-IP; p18-20; MGC2354; FLJ38134; FLJ92039; |
| Gene ID | 966 |
| mRNA Refseq | NM_000611 |
| Protein Refseq | NP_000602 |
| MIM | 107271 |
| UniProt ID | P13987 |
| ◆ Recombinant Proteins | ||
| CD59-392C | Recombinant Cynomolgus CD59 protein(Met1-Glu101), His-tagged | +Inquiry |
| CD59-3740H | Recombinant Human CD59 protein, rFc-tagged | +Inquiry |
| CD59-140C | Recombinant Cynomolgus Monkey CD59 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CD59-918R | Recombinant Rat CD59 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CD59-6833R | Recombinant Rhesus monkey CD59 protein, His & S-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD59-1365RCL | Recombinant Rat CD59 cell lysate | +Inquiry |
| CD59-1019CCL | Recombinant Cynomolgus CD59 cell lysate | +Inquiry |
| CD59-1968HCL | Recombinant Human CD59 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD59 Products
Required fields are marked with *
My Review for All CD59 Products
Required fields are marked with *



