Recombinant Human CD59 Protein

• Cat.No.: CD59-6744H
• Product Overview: Recombinant Human CD59 Protein was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Form: Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.0, with 1 mM DTT, 5 % trehalose.
• Molecular Mass: Approximately 9.0 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids.
• AASequence: LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
• Endotoxin: Less than 0.1 EU/μg of rHuCD59 as determined by LAL method.
• Purity: > 97 % by SDS-PAGE analyses.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. - 12 months from date of receipt, -20 to -70 °C as supplied. - 1 month, 2 to 8 °C under sterile conditions after reconstitution. - 3 months, -20 to -70 °C under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: CD59 CD59 molecule, complement regulatory protein [ Homo sapiens ]
• Official Symbol: CD59
• Synonyms: CD59; CD59 molecule, complement regulatory protein; CD59 antigen p18 20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344) , CD59 antigen, complement regulatory protein , MIC11, MIN1, MIN2, MIN3, MSK21; CD59 glycoprotein; 16.3A5; EJ16; EJ30; EL32; G344; p18 20; protectin; 1F5 antigen; MEM43 antigen; Ly-6-like protein; T cell-activating protein; human leukocyte antigen MIC11; lymphocytic antigen CD59/MEM43; 20 kDa homologous restriction factor; membrane inhibitor of reactive lysis; membrane attack complex inhibition factor; membrane attack complex (MAC) inhibition factor; surface anitgen recognized by monoclonal 16.3A5; CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344); 1F5; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; HRF-20; MAC-IP; p18-20; MGC2354; FLJ38134; FLJ92039
• Gene ID: 966
• mRNA Refseq: NM_000611
• Protein Refseq: NP_000602
• MIM: 107271
• UniProt ID: P13987