Recombinant Human CD6
| Cat.No. : | CD6-27581TH |
| Product Overview : | Recombinant Human CD6 was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | This gene encodes a protein found on the outer membrane of T-lymphocytes as well as some other immune cells. The encoded protein contains three scavenger receptor cysteine-rich (SRCR) domains and a binding site for an activated leukocyte cell adhesion mol |
| Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Molecular Mass : | 68.9 kDa |
| AA Sequence : | MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALWD SRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVVEHACRSDGRR ARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHR DQVNCSGAEAYLWDCPGLPGQHYCGHKEDA |
| Applications : | Antibody Production.Functional Study: Recommended usage only, not validated yet.Compound Screening: Recommended usage only, not validated yet. |
| Notes : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | CD6 CD6 molecule [ Homo sapiens ] |
| Official Symbol | CD6 |
| Synonyms | CD6; CD6 molecule; CD6 antigen; T-cell differentiation antigen CD6; Tp120; T12; TP120; FLJ44171; |
| Gene ID | 923 |
| mRNA Refseq | NM_001254750 |
| Protein Refseq | NP_001241679 |
| MIM | 186720 |
| UniProt ID | P30203 |
| Chromosome Location | 11q12.2 |
| Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; |
| Function | scavenger receptor activity; |
| ◆ Recombinant Proteins | ||
| CD6-4377H | Recombinant Human CD6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CD6-1240M | Acitve Recombinant Mouse CD6 protein(Met1-Gly396), His-tagged | +Inquiry |
| Cd6-5170M | Active Recombinant Mouse Cd6 protein(Met1-Val243), hFc-tagged | +Inquiry |
| CD6-3741H | Recombinant Human CD6 protein, rFc-tagged | +Inquiry |
| CD6-4662H | Recombinant Human CD6 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD6-958RCL | Recombinant Rat CD6 cell lysate | +Inquiry |
| CD6-1807MCL | Recombinant Mouse CD6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD6 Products
Required fields are marked with *
My Review for All CD6 Products
Required fields are marked with *
