Recombinant Human CD6 protein, His/T7-tagged
Cat.No. : | CD6-312H |
Product Overview : | Recombinant Human CD6(18-402 aa) fused with His/T7 tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 18-402 a.a. |
Description : | This gene encodes a protein found on the outer membrane of T-lymphocytes as well as some other immune cells. The encoded protein contains three scavenger receptor cysteine-rich (SRCR) domains and a binding site for an activated leukocyte cell adhesion molecule. The gene product is important for continuation of T cell activation. This gene may be associated with susceptibility to multiple sclerosis (PMID: 19525953, 21849685). Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 44 kDa |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFHPSPAPPDQLNTSSAESELWE PGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALWDSRAAEAVCRALGC GGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCE VVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDD TWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLW DCPGLPGQHYCGHKEDAGAVCSEHQSWRLTGGADRCEGQVEVHFRGVWNT VCDSEWYPSEAKVLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLS NCSWRFNNSNLCSQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVT VKIENKESRELMLL |
Purity : | >90% by SDS-PAGE. |
Applications : | SDS-PAGE |
Concentration : | 50 µg at 0.5 mg/ml |
Shipping : | Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. |
Gene Name | CD6 CD6 molecule [ Homo sapiens ] |
Official Symbol | CD6 |
Synonyms | CD6; CD6 molecule; CD6 antigen; T-cell differentiation antigen CD6; Tp120; T12; TP120; FLJ44171; |
Gene ID | 923 |
mRNA Refseq | NM_001254750 |
Protein Refseq | NP_001241679 |
MIM | 186720 |
UniProt ID | P30203 |
Chromosome Location | 11q12.2 |
Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; |
Function | scavenger receptor activity; |
◆ Recombinant Proteins | ||
CD6-4759H | Recombinant Human CD6 Molecule, His-tagged | +Inquiry |
Cd6-10527M | Recombinant Mouse Cd6 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD6-4760H | Active Recombinant Human CD6 protein, hFc-tagged | +Inquiry |
CD6-1650H | Recombinant Human CD6 protein, His-tagged | +Inquiry |
Cd6-6896M | Recombinant Mouse Cd6, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD6-1807MCL | Recombinant Mouse CD6 cell lysate | +Inquiry |
CD6-958RCL | Recombinant Rat CD6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD6 Products
Required fields are marked with *
My Review for All CD6 Products
Required fields are marked with *
0
Inquiry Basket