Recombinant Human CD63 protein, His-tagged
| Cat.No. : | CD63-2668H |
| Product Overview : | Recombinant Human CD63 protein(P08962)(103-203aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 103-203aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 15.5 kDa |
| AA Sequence : | AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CD63 CD63 molecule [ Homo sapiens ] |
| Official Symbol | CD63 |
| Synonyms | CD63; CD63 molecule; CD63 antigen (melanoma 1 antigen) , MLA1; CD63 antigen; ME491; TSPAN30; tspan-30; granulophysin; tetraspanin-30; melanoma-associated antigen MLA1; CD63 antigen (melanoma 1 antigen); melanoma-associated antigen ME491; ocular melanoma-associated antigen; lysosomal-associated membrane protein 3; lysosome-associated membrane glycoprotein 3; MLA1; LAMP-3; OMA81H; |
| Gene ID | 967 |
| mRNA Refseq | NM_001257389 |
| Protein Refseq | NP_001244318 |
| MIM | 155740 |
| UniProt ID | P08962 |
| ◆ Recombinant Proteins | ||
| CD63-6837H | Recombinant Human CD63 protein, His & GST-tagged | +Inquiry |
| CD63-3742H | Recombinant Human CD63 protein, rFc-tagged | +Inquiry |
| RFL8789FF | Recombinant Full Length Cat Cd63 Antigen(Cd63) Protein, His-Tagged | +Inquiry |
| Cd63-2669M | Recombinant Mouse Cd63 protein, His-tagged | +Inquiry |
| Cd63-30R | Recombinant Rat Cd63, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD63-001RCL | Recombinant Rat CD63 cell lysate | +Inquiry |
| CD63-814CCL | Recombinant Cynomolgus CD63 cell lysate | +Inquiry |
| CD63-1553SCL | Recombinant Sus scrofa (Pig) CD63 cell lysate | +Inquiry |
| CD63-1913HCL | Recombinant Human CD63 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD63 Products
Required fields are marked with *
My Review for All CD63 Products
Required fields are marked with *
