Recombinant Human CD63 protein, His-tagged
Cat.No. : | CD63-2668H |
Product Overview : | Recombinant Human CD63 protein(P08962)(103-203aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 103-203aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.5 kDa |
AA Sequence : | AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CD63 CD63 molecule [ Homo sapiens ] |
Official Symbol | CD63 |
Synonyms | CD63; CD63 molecule; CD63 antigen (melanoma 1 antigen) , MLA1; CD63 antigen; ME491; TSPAN30; tspan-30; granulophysin; tetraspanin-30; melanoma-associated antigen MLA1; CD63 antigen (melanoma 1 antigen); melanoma-associated antigen ME491; ocular melanoma-associated antigen; lysosomal-associated membrane protein 3; lysosome-associated membrane glycoprotein 3; MLA1; LAMP-3; OMA81H; |
Gene ID | 967 |
mRNA Refseq | NM_001257389 |
Protein Refseq | NP_001244318 |
MIM | 155740 |
UniProt ID | P08962 |
◆ Recombinant Proteins | ||
Cd63-2669M | Recombinant Mouse Cd63 protein, His-tagged | +Inquiry |
RFL3211OF | Recombinant Full Length Rabbit Cd63 Antigen(Cd63) Protein, His-Tagged | +Inquiry |
CD63-203H | Recombinant Human CD63 Protein, C-His-tagged | +Inquiry |
CD63-2512H | Recombinant Human CD63 Protein (103-203 aa), His-sumostar-tagged | +Inquiry |
CD63-1382H | Recombinant Human CD63 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD63-001RCL | Recombinant Rat CD63 cell lysate | +Inquiry |
CD63-814CCL | Recombinant Cynomolgus CD63 cell lysate | +Inquiry |
CD63-1553SCL | Recombinant Sus scrofa (Pig) CD63 cell lysate | +Inquiry |
CD63-1913HCL | Recombinant Human CD63 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD63 Products
Required fields are marked with *
My Review for All CD63 Products
Required fields are marked with *