Recombinant Human CD69 molecule Protein, His-tagged

Cat.No. : CD69-151H
Product Overview : Recombinant Human CD69 Protein (64-199aa) with C-His tag was expressed in HEK293.
Availability June 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 64-199aa
Description : This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets.
Tag : C-His
Molecular Mass : 17 kDa
AA Sequence : GQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYKHHHHHHHH
Endotoxin : < 1 EU/μg by LAL.
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1 mg/mL by BCA
Storage Buffer : Sterile PBS, pH 7.4
Gene Name CD69 CD69 molecule [Homo sapiens (human)]
Official Symbol CD69
Synonyms CD69; CD69 molecule; CD69 antigen (p60, early T cell activation antigen); early activation antigen CD69; CLEC2C; leukocyte surface antigen Leu-23; early T-cell activation antigen p60; early lymphocyte activation antigen; activation inducer molecule (AIM/CD69); C-type lectin domain family 2, member C; CD69 antigen (p60, early T-cell activation antigen); AIM; EA1; MLR-3; GP32/28; BL-AC/P26
Gene ID 969
mRNA Refseq NM_001781
Protein Refseq NP_001772
MIM 107273
UniProt ID Q07108

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD69 Products

Required fields are marked with *

My Review for All CD69 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon