Recombinant Human CD69 molecule Protein, His-tagged
| Cat.No. : | CD69-151H |
| Product Overview : | Recombinant Human CD69 Protein (64-199aa) with C-His tag was expressed in HEK293. |
| Availability | January 31, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 64-199aa |
| Description : | This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets. |
| Tag : | C-His |
| Molecular Mass : | 17 kDa |
| AA Sequence : | GQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYKHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL. |
| Purity : | > 90 % by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1 mg/mL by BCA |
| Storage Buffer : | Sterile PBS, pH 7.4 |
| Gene Name | CD69 CD69 molecule [Homo sapiens (human)] |
| Official Symbol | CD69 |
| Synonyms | CD69; CD69 molecule; CD69 antigen (p60, early T cell activation antigen); early activation antigen CD69; CLEC2C; leukocyte surface antigen Leu-23; early T-cell activation antigen p60; early lymphocyte activation antigen; activation inducer molecule (AIM/CD69); C-type lectin domain family 2, member C; CD69 antigen (p60, early T-cell activation antigen); AIM; EA1; MLR-3; GP32/28; BL-AC/P26 |
| Gene ID | 969 |
| mRNA Refseq | NM_001781 |
| Protein Refseq | NP_001772 |
| MIM | 107273 |
| UniProt ID | Q07108 |
| ◆ Recombinant Proteins | ||
| Cd69-695R | Recombinant Rat Cd69 Protein, His-tagged | +Inquiry |
| CD69-694H | Recombinant Human CD69 Protein, His-tagged | +Inquiry |
| CD69-2225H | Recombinant Human CD69 protein, His-tagged | +Inquiry |
| CD69-151H | Recombinant Human CD69 molecule Protein, His-tagged | +Inquiry |
| CD69-3744H | Recombinant Human CD69 protein, rFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD69-2573HCL | Recombinant Human CD69 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD69 Products
Required fields are marked with *
My Review for All CD69 Products
Required fields are marked with *
