Recombinant Human CD70 molecule Protein, His tagged
| Cat.No. : | CD70-001H |
| Product Overview : | Recombinant Human CD70 Protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 45-193 aa |
| Description : | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. |
| Tag : | C-His |
| Molecular Mass : | 18 kDa |
| AA Sequence : | QQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRPHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Concentration : | 0.75 mg/mL by BCA |
| Gene Name | CD70 CD70 molecule [ Homo sapiens (human) ] |
| Official Symbol | CD70 |
| Synonyms | CD70; CD70 molecule; CD27LG, TNFSF7, tumor necrosis factor (ligand) superfamily, member 7; CD70 antigen; CD27L; CD27-L; CD27 ligand; Ki-24 antigen; surface antigen CD70; tumor necrosis factor ligand superfamily member 7; tumor necrosis factor (ligand) superfamily, member 7; CD27LG; TNFSF7 |
| Gene ID | 970 |
| mRNA Refseq | NM_001252 |
| Protein Refseq | NP_001243 |
| MIM | 602840 |
| UniProt ID | P32970 |
| ◆ Recombinant Proteins | ||
| CD70-56H | Recombinant Human CD70 protein, His-tagged | +Inquiry |
| CD70-206H | Recombinant Human CD70 Protein, C-His-tagged | +Inquiry |
| CD70-545H | Recombinant Human CD70 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CD70-639A | Recombinant Human CD70 protein, Fc-tagged, APC labeled | +Inquiry |
| CD70-436H | Recombinant Human CD70 Protein (Gln39-Pro193), MIgG1 Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD70-1303RCL | Recombinant Rat CD70 cell lysate | +Inquiry |
| CD70-2710HCL | Recombinant Human CD70 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD70 Products
Required fields are marked with *
My Review for All CD70 Products
Required fields are marked with *
