Recombinant Human CD74, GST-Tagged

Cat.No. : CD74-2230H
Product Overview : Recombinant Human CD74 encoding full-length human CD74 ( 1a.a. - 160 a.a.) , fused a GST-tag at N-terminal, was expressed in Wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Sequence : MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLGWV
MW (kDa) : 43.34
Preparation Method : in vitro wheat germ expression system
Purification : Glutathione Sepharose 4 Fast Flow
Applications : Antibody Production; Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Protein Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name CD74 CD74 molecule, major histocompatibility complex, class II invariant chain [ Homo sapiens ]
Official Symbol CD74
Synonyms CD74 molecule, major histocompatibility complex, class II invariant chain; DHLAG; HLADG; Ia-GAMMA; CD74; HLA class II histocompatibility antigen gamma chain; ii; p33; HLA-DR-gamma; MHC HLA-DR gamma chain; Ia-associated invariant chain; gamma chain of class II antigens; ia antigen-associated invariant chain; HLA-DR antigens-associated invariant chain; CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated); CD74 antigen
Gene ID 972
mRNA Refseq NM_004355
Protein Refseq NP_004346
MIM 142790
UniProt ID P04233
Chromosome Location 5q32
Pathway Antigen processing and presentation
Function MHC class II protein binding; beta-amyloid binding; cytokine binding; cytokine receptor activity; identical protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD74 Products

Required fields are marked with *

My Review for All CD74 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon