Recombinant Human CD8A protein, His-tagged
Cat.No. : | CD8A-2494H |
Product Overview : | Recombinant Human CD8A protein(23-183 aa), fused to His tag, was expressed in E. coli. |
Availability | September 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-183 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CD8A CD8a molecule [ Homo sapiens ] |
Official Symbol | CD8A |
Synonyms | CD8A; CD8a molecule; CD8, CD8 antigen, alpha polypeptide (p32) , T cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 alpha chain; T8 T-cell antigen; T cell co-receptor; OKT8 T-cell antigen; T-cell antigen Leu2; Leu2 T-lymphocyte antigen; CD8 antigen, alpha polypeptide (p32); T-lymphocyte differentiation antigen T8/Leu-2; CD8; MAL; p32; Leu2; |
Gene ID | 925 |
mRNA Refseq | NM_001145873 |
Protein Refseq | NP_001139345 |
MIM | 186910 |
UniProt ID | P01732 |
◆ Recombinant Proteins | ||
CD8A-176H | Recombinant Human CD8A Protein, C-His-tagged | +Inquiry |
Cd8a-28R | Recombinant Rat Cd8a, Fc tagged | +Inquiry |
CD8A-3196H | Active Recombinant Human CD8A protein, His-tagged | +Inquiry |
CD8A-273H | Recombinant Human CD8A protein, His-tagged | +Inquiry |
CD8A-10982H | Recombinant Human CD8A, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD8A-2514MCL | Recombinant Mouse CD8A cell lysate | +Inquiry |
CD8A-827RCL | Recombinant Rat CD8A cell lysate | +Inquiry |
CD8A-2493HCL | Recombinant Human CD8A cell lysate | +Inquiry |
CD8A-1872FCL | Recombinant Ferret CD8A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD8A Products
Required fields are marked with *
My Review for All CD8A Products
Required fields are marked with *