Recombinant Human CDH23 Protein, GST-Tagged

Cat.No. : CDH23-0987H
Product Overview : Human CDH23 partial ORF (NP_071407, 29 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is thought to be involved in stereocilia organization and hair bundle formation. The gene is located in a region containing the human deafness loci DFNB12 and USH1D. Usher syndrome 1D and nonsyndromic autosomal recessive deafness DFNB12 are caused by allelic mutations of this cadherin-like gene. Upregulation of this gene may also be associated with breast cancer. Alternative splice variants encoding different isoforms have been described. [provided by RefSeq, May 2013]
Molecular Mass : 35.2 kDa
AA Sequence : PFFTNHFFDTYLLISEDTPVGSSVTQLLAQDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDH23 cadherin-related 23 [ Homo sapiens ]
Official Symbol CDH23
Synonyms CDH23; cadherin-related 23; cadherin related 23, cadherin like 23, DFNB12, USH1D; cadherin-23; cadherin related family member 23; CDHR23; otocadherin; cadherin-like 23; cadherin-related family member 23; USH1D; FLJ00233; FLJ36499; KIAA1774; KIAA1812; MGC102761; DKFZp434P2350;
Gene ID 64072
mRNA Refseq NM_001171930
Protein Refseq NP_001165401
MIM 605516
UniProt ID Q9H251

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDH23 Products

Required fields are marked with *

My Review for All CDH23 Products

Required fields are marked with *

0
cart-icon