Recombinant Human CDH23 Protein, GST-Tagged
Cat.No. : | CDH23-0987H |
Product Overview : | Human CDH23 partial ORF (NP_071407, 29 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is thought to be involved in stereocilia organization and hair bundle formation. The gene is located in a region containing the human deafness loci DFNB12 and USH1D. Usher syndrome 1D and nonsyndromic autosomal recessive deafness DFNB12 are caused by allelic mutations of this cadherin-like gene. Upregulation of this gene may also be associated with breast cancer. Alternative splice variants encoding different isoforms have been described. [provided by RefSeq, May 2013] |
Molecular Mass : | 35.2 kDa |
AA Sequence : | PFFTNHFFDTYLLISEDTPVGSSVTQLLAQDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDH23 cadherin-related 23 [ Homo sapiens ] |
Official Symbol | CDH23 |
Synonyms | CDH23; cadherin-related 23; cadherin related 23, cadherin like 23, DFNB12, USH1D; cadherin-23; cadherin related family member 23; CDHR23; otocadherin; cadherin-like 23; cadherin-related family member 23; USH1D; FLJ00233; FLJ36499; KIAA1774; KIAA1812; MGC102761; DKFZp434P2350; |
Gene ID | 64072 |
mRNA Refseq | NM_001171930 |
Protein Refseq | NP_001165401 |
MIM | 605516 |
UniProt ID | Q9H251 |
◆ Recombinant Proteins | ||
CDH23-951R | Recombinant Rat CDH23 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDH23-429H | Recombinant Human CDH23 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDH23-12819Z | Recombinant Zebrafish CDH23 | +Inquiry |
CDH23-3148HF | Recombinant Full Length Human CDH23 Protein | +Inquiry |
CDH23-471H | Recombinant Human CDH23 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH23 Products
Required fields are marked with *
My Review for All CDH23 Products
Required fields are marked with *
0
Inquiry Basket