"CDH23" Related Products

Recombinant Human CDH23 Protein, GST-Tagged

Cat.No.: CDH23-0987H
Product Overview: Human CDH23 partial ORF (NP_071407, 29 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is thought to be involved in stereocilia organization and hair bundle formation. The gene is located in a region containing the human deafness loci DFNB12 and USH1D. Usher syndrome 1D and nonsyndromic autosomal recessive deafness DFNB12 are caused by allelic mutations of this cadherin-like gene. Upregulation of this gene may also be associated with breast cancer. Alternative splice variants encoding different isoforms have been described. [provided by RefSeq, May 2013]
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 35.2 kDa
AA Sequence: PFFTNHFFDTYLLISEDTPVGSSVTQLLAQDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVI
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: CDH23 cadherin-related 23 [ Homo sapiens ]
Official Symbol: CDH23
Synonyms: CDH23; cadherin-related 23; cadherin related 23, cadherin like 23, DFNB12, USH1D; cadherin-23; cadherin related family member 23; CDHR23; otocadherin; cadherin-like 23; cadherin-related family member 23; USH1D; FLJ00233; FLJ36499; KIAA1774; KIAA1812; MGC102761; DKFZp434P2350;
Gene ID: 64072
mRNA Refseq: NM_001171930
Protein Refseq: NP_001165401
MIM: 605516
UniProt ID: Q9H251

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.