Recombinant Human CDK2AP1 Protein, GST-Tagged
| Cat.No. : | CDK2AP1-1005H |
| Product Overview : | Human CDK2AP1 full-length ORF (AAH34717, 1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a cyclin-dependent kinase 2 (CDK2) -associated protein which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggests a regulatory role in DNA replication during the S-phase of the cell cycle. This protein also forms a core subunit of the nucleosome remodeling and histone deacetylation (NURD) complex that epigenetically regulates embryonic stem cell differentiation. This gene thus plays a role in both cell-cycle and epigenetic regulation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2012] |
| Molecular Mass : | 38.39 kDa |
| AA Sequence : | MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDK2AP1 cyclin-dependent kinase 2 associated protein 1 [ Homo sapiens ] |
| Official Symbol | CDK2AP1 |
| Synonyms | CDK2AP1; cyclin-dependent kinase 2 associated protein 1; CDK2 associated protein 1; cyclin-dependent kinase 2-associated protein 1; doc 1; DOC1; DORC1; p12DOC 1; ST19; Deleted in oral cancer-1; deleted in oral cancer 1; CDK2-associated protein 1; putative oral cancer suppressor; doc-1; p12DOC-1; |
| Gene ID | 8099 |
| mRNA Refseq | NM_004642 |
| Protein Refseq | NP_004633 |
| MIM | 602198 |
| UniProt ID | O14519 |
| ◆ Recombinant Proteins | ||
| CDK2AP1-11047H | Recombinant Human CDK2AP1 protein, GST-tagged | +Inquiry |
| CDK2AP1-5275H | Recombinant Human CDK2AP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CDK2AP1-3201M | Recombinant Mouse CDK2AP1 Protein | +Inquiry |
| CDK2AP1-27911TH | Recombinant Human CDK2AP1, His-tagged | +Inquiry |
| CDK2AP1-1936H | Recombinant Human CDK2AP1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDK2AP1-7628HCL | Recombinant Human CDK2AP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDK2AP1 Products
Required fields are marked with *
My Review for All CDK2AP1 Products
Required fields are marked with *
