Recombinant Human CDK5R1 Protein, GST-Tagged
Cat.No. : | CDK5R1-1022H |
Product Overview : | Human CDK5R1 full-length ORF (AAH20580.1, 1 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer's disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer's disease. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 60.5 kDa |
AA Sequence : | MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDK5R1 cyclin-dependent kinase 5, regulatory subunit 1 (p35) [ Homo sapiens ] |
Official Symbol | CDK5R1 |
Synonyms | CDK5R1; cyclin-dependent kinase 5, regulatory subunit 1 (p35); cyclin-dependent kinase 5 activator 1; Nck5a; p35nck5a; CDK5 activator 1; neuronal CDK5 activator; TPKII regulatory subunit; regulatory partner for CDK5 kinase; tau protein kinase II 23kDa subunit; cyclin-dependent kinase 5 regulatory subunit 1; p23; p25; p35; CDK5R; NCK5A; CDK5P35; MGC33831; |
Gene ID | 8851 |
mRNA Refseq | NM_003885 |
Protein Refseq | NP_003876 |
MIM | 603460 |
UniProt ID | Q15078 |
◆ Recombinant Proteins | ||
CDK5R1-964R | Recombinant Rat CDK5R1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDK5R1-786R | Recombinant Rhesus monkey CDK5R1 Protein, His-tagged | +Inquiry |
CDK5R1-687B | Recombinant Bovine CDK5R1, GST-tagged | +Inquiry |
CDK5R1-669H | Recombinant Human CDK5R1 | +Inquiry |
CDK5R1-3205M | Recombinant Mouse CDK5R1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK5R1-7625HCL | Recombinant Human CDK5R1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDK5R1 Products
Required fields are marked with *
My Review for All CDK5R1 Products
Required fields are marked with *
0
Inquiry Basket