Recombinant Human CDKN1B Protein, GST-Tagged
Cat.No. : | CDKN1B-1056H |
Product Overview : | Human CDKN1B full-length ORF (AAH01971, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Mutations in this gene are associated with multiple endocrine neoplasia type IV (MEN4). [provided by RefSeq, Apr 2014] |
Molecular Mass : | 47.52 kDa |
AA Sequence : | MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDGSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATGDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDKN1B cyclin-dependent kinase inhibitor 1B (p27, Kip1) [ Homo sapiens ] |
Official Symbol | CDKN1B |
Synonyms | CDKN1B; cyclin-dependent kinase inhibitor 1B (p27, Kip1); cyclin-dependent kinase inhibitor 1B; KIP1; P27KIP1; MEN4; CDKN4; MEN1B; |
Gene ID | 1027 |
mRNA Refseq | NM_004064 |
Protein Refseq | NP_004055 |
MIM | 600778 |
UniProt ID | P46527 |
◆ Recombinant Proteins | ||
CDKN1B-006H | Recombinant Human CDKN1B Protein, DDK-tagged | +Inquiry |
CDKN1B-3259H | Recombinant Human CDKN1B protein, His-tagged | +Inquiry |
CDKN1B-4158H | Recombinant Human CDKN1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDKN1B-3192HF | Recombinant Full Length Human CDKN1B Protein, GST-tagged | +Inquiry |
Cdkn1b-1252M | Recombinant Mouse Cdkn1b protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDKN1B-7617HCL | Recombinant Human CDKN1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDKN1B Products
Required fields are marked with *
My Review for All CDKN1B Products
Required fields are marked with *