Recombinant Human CDKN1B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CDKN1B-4158H |
Product Overview : | CDKN1B MS Standard C13 and N15-labeled recombinant protein (NP_004055) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Mutations in this gene are associated with multiple endocrine neoplasia type IV (MEN4). |
Molecular Mass : | 21.9 kDa |
AA Sequence : | MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CDKN1B cyclin dependent kinase inhibitor 1B [ Homo sapiens (human) ] |
Official Symbol | CDKN1B |
Synonyms | CDKN1B; cyclin-dependent kinase inhibitor 1B (p27, Kip1); cyclin-dependent kinase inhibitor 1B; KIP1; P27KIP1; MEN4; CDKN4; MEN1B; |
Gene ID | 1027 |
mRNA Refseq | NM_004064 |
Protein Refseq | NP_004055 |
MIM | 600778 |
UniProt ID | P46527 |
◆ Recombinant Proteins | ||
CDKN1B-2499H | Recombinant Human Cyclin-Dependent Kinase Inhibitor 1B (p27, Kip1), His-tagged | +Inquiry |
CDKN1B-006H | Recombinant Human CDKN1B Protein, DDK-tagged | +Inquiry |
CDKN1B-1954H | Recombinant Human CDKN1B protein, His-tagged | +Inquiry |
CDKN1B-568H | Recombinant Human CDKN1B Protein, His (Fc)-Avi-tagged | +Inquiry |
CDKN1B-620R | Recombinant Rhesus Macaque CDKN1B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDKN1B-7617HCL | Recombinant Human CDKN1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDKN1B Products
Required fields are marked with *
My Review for All CDKN1B Products
Required fields are marked with *
0
Inquiry Basket