Recombinant Human CDSN Protein, GST-Tagged

Cat.No. : CDSN-1079H
Product Overview : Human CDSN partial ORF (NP_001255, 306 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein found in corneodesmosomes, which localize to human epidermis and other cornified squamous epithelia. The encoded protein undergoes a series of cleavages during corneocyte maturation. This gene is highly polymorphic in human populations, and variation has been associated with skin diseases such as psoriasis, hypotrichosis and peeling skin syndrome. The gene is located in the major histocompatibility complex (MHC) class I region on chromosome 6. [provided by RefSeq, Dec 2014]
Molecular Mass : 31.24 kDa
AA Sequence : YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDSN corneodesmosin [ Homo sapiens ]
Official Symbol CDSN
Synonyms CDSN; corneodesmosin; D6S586E; differentiated keratinocyte S protein; S; PSS; HTSS; HTSS1;
Gene ID 1041
mRNA Refseq NM_001264
Protein Refseq NP_001255
MIM 602593
UniProt ID Q15517

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDSN Products

Required fields are marked with *

My Review for All CDSN Products

Required fields are marked with *

0
cart-icon