Recombinant Human CDX2 protein, GST-tagged
Cat.No. : | CDX2-1835H |
Product Overview : | Recombinant Human CDX2 protein(1-180 aa), fused to GST tag, was expressed in E. coli. |
Availability | October 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-180 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CDX2 caudal type homeobox 2 [ Homo sapiens ] |
Official Symbol | CDX2 |
Synonyms | CDX2; caudal type homeobox 2; caudal type homeo box transcription factor 2 , CDX3; homeobox protein CDX-2; caudal-type homeobox protein 2; caudal type homeobox transcription factor 2; caudal type homeo box transcription factor 2; CDX3; CDX-3; |
Gene ID | 1045 |
mRNA Refseq | NM_001265 |
Protein Refseq | NP_001256 |
MIM | 600297 |
UniProt ID | Q99626 |
◆ Recombinant Proteins | ||
CDX2-1552M | Recombinant Mouse CDX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDX2-600H | Recombinant Human CDX2 Protein, His/GST-tagged | +Inquiry |
CDX2-3242M | Recombinant Mouse CDX2 Protein | +Inquiry |
CDX2-11075H | Recombinant Human CDX2, His-tagged | +Inquiry |
CDX2-75HF | Recombinant Full Length Human CDX2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDX2-7602HCL | Recombinant Human CDX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDX2 Products
Required fields are marked with *
My Review for All CDX2 Products
Required fields are marked with *