Recombinant Human CEACAM4 Protein (36-155 aa), His-tagged
| Cat.No. : | CEACAM4-1356H |
| Product Overview : | Recombinant Human CEACAM4 Protein (36-155 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 36-155 aa |
| Description : | Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 14.7 kDa |
| AA Sequence : | FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | CEACAM4 carcinoembryonic antigen-related cell adhesion molecule 4 [ Homo sapiens ] |
| Official Symbol | CEACAM4 |
| Synonyms | CEACAM4; CGM7; NCA; CGM7_HUMAN; |
| Gene ID | 1089 |
| mRNA Refseq | NM_001817 |
| Protein Refseq | NP_001808 |
| UniProt ID | O75871 |
| ◆ Recombinant Proteins | ||
| CEACAM4-12H | Recombinant Human CEACAM4 protein, His-tagged | +Inquiry |
| CEACAM4-2278H | Recombinant Human CEACAM4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CEACAM4-571H | Recombinant Human CEACAM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CEACAM4-3193H | Recombinant Human CEACAM4 Protein, MYC/DDK-tagged | +Inquiry |
| CEACAM4-1356H | Recombinant Human CEACAM4 Protein (36-155 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM4 Products
Required fields are marked with *
My Review for All CEACAM4 Products
Required fields are marked with *
