Recombinant Human CEACAM4 Protein (36-155 aa), His-tagged

Cat.No. : CEACAM4-1356H
Product Overview : Recombinant Human CEACAM4 Protein (36-155 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 36-155 aa
Description : Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 14.7 kDa
AA Sequence : FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name CEACAM4 carcinoembryonic antigen-related cell adhesion molecule 4 [ Homo sapiens ]
Official Symbol CEACAM4
Synonyms CEACAM4; CGM7; NCA; CGM7_HUMAN;
Gene ID 1089
mRNA Refseq NM_001817
Protein Refseq NP_001808
UniProt ID O75871

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CEACAM4 Products

Required fields are marked with *

My Review for All CEACAM4 Products

Required fields are marked with *

0
cart-icon
0
compare icon