"CEACAM4" Related Products

Recombinant Human CEACAM4 Protein (36-155 aa), His-tagged

Cat.No. : CEACAM4-1356H
Product Overview : Recombinant Human CEACAM4 Protein (36-155 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.
Description : Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.
Source : Yeast
Species : Human
Tag : His
Form : Tris-based buffer,50% glycerol
Molecular Mass : 14.7 kDa
Protein length : 36-155 aa
AA Sequence : FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Figure :

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Gene Name : CEACAM4 carcinoembryonic antigen-related cell adhesion molecule 4 [ Homo sapiens ]
Official Symbol : CEACAM4
Synonyms : CEACAM4; CGM7; NCA; CGM7_HUMAN;
Gene ID : 1089
mRNA Refseq : NM_001817
Protein Refseq : NP_001808
UniProt ID : O75871

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.