Recombinant Human CEACAM4 Protein (36-155 aa), His-tagged
Cat.No. : | CEACAM4-1356H |
Product Overview : | Recombinant Human CEACAM4 Protein (36-155 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 36-155 aa |
Description : | Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 14.7 kDa |
AA Sequence : | FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | CEACAM4 carcinoembryonic antigen-related cell adhesion molecule 4 [ Homo sapiens ] |
Official Symbol | CEACAM4 |
Synonyms | CEACAM4; CGM7; NCA; CGM7_HUMAN; |
Gene ID | 1089 |
mRNA Refseq | NM_001817 |
Protein Refseq | NP_001808 |
UniProt ID | O75871 |
◆ Recombinant Proteins | ||
CEACAM4-571H | Recombinant Human CEACAM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CEACAM4-3193H | Recombinant Human CEACAM4 Protein, MYC/DDK-tagged | +Inquiry |
CEACAM4-1553HFL | Recombinant Full Length Human CEACAM4 Protein, C-Flag-tagged | +Inquiry |
CEACAM4-12H | Recombinant Human CEACAM4 protein, His-tagged | +Inquiry |
CEACAM4-1356H | Recombinant Human CEACAM4 Protein (36-155 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM4 Products
Required fields are marked with *
My Review for All CEACAM4 Products
Required fields are marked with *