Recombinant Human CEACAM4 protein, His-tagged
| Cat.No. : | CEACAM4-12H |
| Product Overview : | Recombinant Human CEACAM4(36-155aa) fused with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 36-155 a.a. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 14.6kD |
| AA Sequence : | FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG |
| Purity : | >90% (SDS-PAGE) |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | CEACAM4 carcinoembryonic antigen-related cell adhesion molecule 4 [ Homo sapiens ] |
| Official Symbol | CEACAM4 |
| Synonyms | CEACAM4; carcinoembryonic antigen-related cell adhesion molecule 4; CGM7; carcinoembryonic antigen CGM7; nonspecific cross-reacting antigen W236; Nonspecific cross-reacting antigen (NCA); non-specific cross-reacting antigen W236; carcinoembryonic antigen gene family member 7; NCA; CGM7_HUMAN; |
| Gene ID | 1089 |
| mRNA Refseq | NM_001817 |
| Protein Refseq | NP_001808 |
| UniProt ID | O75871 |
| Chromosome Location | 19q13.2 |
| ◆ Recombinant Proteins | ||
| CEACAM4-1356H | Recombinant Human CEACAM4 Protein (36-155 aa), His-tagged | +Inquiry |
| CEACAM4-2278H | Recombinant Human CEACAM4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CEACAM4-1553HFL | Recombinant Full Length Human CEACAM4 Protein, C-Flag-tagged | +Inquiry |
| CEACAM4-571H | Recombinant Human CEACAM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CEACAM4-12H | Recombinant Human CEACAM4 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM4 Products
Required fields are marked with *
My Review for All CEACAM4 Products
Required fields are marked with *



