Recombinant Human CEACAM5 protein(321-410 aa), C-His-tagged
| Cat.No. : | CEACAM5-2568H |
| Product Overview : | Recombinant Human CEACAM5 protein(P06731)(321-410 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 321-410 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 12.5 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | EPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILN |
| Gene Name | CEACAM5 carcinoembryonic antigen-related cell adhesion molecule 5 [ Homo sapiens ] |
| Official Symbol | CEACAM5 |
| Synonyms | CEACAM5; carcinoembryonic antigen-related cell adhesion molecule 5; CEA; CD66e; meconium antigen 100; DKFZp781M2392; |
| Gene ID | 1048 |
| mRNA Refseq | NM_004363 |
| Protein Refseq | NP_004354 |
| MIM | 114890 |
| UniProt ID | P06731 |
| ◆ Recombinant Proteins | ||
| CEACAM5-1250H | Recombinant Human CEACAM5 protein, His-tagged | +Inquiry |
| CEACAM5-665HAF555 | Recombinant Human CEACAM5 Protein, Fc/His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| CEACAM5-2187C | Recombinant Cynomolgus CEACAM5 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| Ceacam5-22M | Recombinant Mouse Ceacam5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CEACAM5-3274HF | Recombinant Full Length Human CEACAM5 Protein, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CEACAM5-27803TH | Native Human CEACAM5 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CEACAM5-2238HCL | Recombinant Human CEACAM5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM5 Products
Required fields are marked with *
My Review for All CEACAM5 Products
Required fields are marked with *
