Recombinant Human CEACAM5 protein(35-685 aa), N-MBP & C-His-tagged
Cat.No. : | CEACAM5-2569H |
Product Overview : | Recombinant Human CEACAM5 protein(P06731)(35-685 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His&MBP |
Protein Length : | 35-685 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA |
Gene Name | CEACAM5 carcinoembryonic antigen-related cell adhesion molecule 5 [ Homo sapiens ] |
Official Symbol | CEACAM5 |
Synonyms | CEACAM5; carcinoembryonic antigen-related cell adhesion molecule 5; CEA; CD66e; meconium antigen 100; DKFZp781M2392; |
Gene ID | 1048 |
mRNA Refseq | NM_004363 |
Protein Refseq | NP_004354 |
MIM | 114890 |
UniProt ID | P06731 |
◆ Recombinant Proteins | ||
CEACAM5-2186C | Recombinant Cynomolgus CEACAM5 protein, His-tagged | +Inquiry |
CEACAM5-1201H | Recombinant Human Carcinoembryonic Antigen-related Cell Adhesion Molecule 5 | +Inquiry |
CEACAM5-112H | Recombinant Human CEACAM5 Protein, His-tagged | +Inquiry |
CEACAM5-495H | Recombinant Human CEACAM5 Protein (Met1-Ala685), His-tagged, Biotinylated | +Inquiry |
CEACAM5-3200H | Active Recombinant Human CEACAM5 protein(Lys35-Ala685), His-tagged | +Inquiry |
◆ Native Proteins | ||
CEACAM5-27803TH | Native Human CEACAM5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEACAM5-2238HCL | Recombinant Human CEACAM5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM5 Products
Required fields are marked with *
My Review for All CEACAM5 Products
Required fields are marked with *