Recombinant Human CENPE protein, His-tagged
| Cat.No. : | CENPE-3800H |
| Product Overview : | Recombinant Human CENPE protein(2401-2500 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 11, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2401-2500 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MESKIIKMQKELEVTNDIIAKLQAKVHESNKCLEKTKETIQVLQDKVALGAKPYKEEIEDLKMKLVKIDLEKMKNAKEFEKEISATKATVEYQKEVIRLLR |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CENPE centromere protein E, 312kDa [ Homo sapiens ] |
| Official Symbol | CENPE |
| Synonyms | CENPE; centromere protein E, 312kDa; centromere protein E (312kD); centromere-associated protein E; KIF10; PPP1R61; protein phosphatase 1; regulatory subunit 61; kinesin family member 10; kinesin-related protein CENPE; Centromere autoantigen E (312kD); protein phosphatase 1, regulatory subunit 61; CENP-E; |
| Gene ID | 1062 |
| mRNA Refseq | NM_001813 |
| Protein Refseq | NP_001804 |
| MIM | 117143 |
| UniProt ID | Q02224 |
| ◆ Recombinant Proteins | ||
| Cenpe-349R | Recombinant Rat Cenpe Protein, His-tagged | +Inquiry |
| CENPE-4563Z | Recombinant Zebrafish CENPE | +Inquiry |
| CENPE-348H | Recombinant Human CENPE Protein, His-tagged | +Inquiry |
| CENPE-3800H | Recombinant Human CENPE protein, His-tagged | +Inquiry |
| CENPE-1114H | Recombinant Human CENPE Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CENPE Products
Required fields are marked with *
My Review for All CENPE Products
Required fields are marked with *
