Recombinant Human CENPE Protein, GST-Tagged

Cat.No. : CENPE-1114H
Product Overview : Human CENPE partial ORF (NP_001804, 309 a.a. - 419 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Centrosome-associated protein E (CENPE) is a kinesin-like motor protein that accumulates in the G2 phase of the cell cycle. Unlike other centrosome-associated proteins, it is not present during interphase and first appears at the centromere region of chromosomes during prometaphase. This protein is required for stable spindle microtubule capture at kinetochores which is a necessary step in chromosome alignment during prometaphase. This protein also couples chromosome position to microtubule depolymerizing activity. Alternative splicing results in multiple transcript variants encoding distinct protein isoforms. [provided by RefSeq, Nov 2014]
Molecular Mass : 37.95 kDa
AA Sequence : TPVSFDETLTALQFASTAKYMKNTPYVNEVSTDEALLKRYRKEIMDLKKQLEEVSLETRAQAMEKDQLAQLLEEKDLLQKVQNEKIENLTRMLVTSSSLTLQQELKAKRKR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CENPE centromere protein E, 312kDa [ Homo sapiens ]
Official Symbol CENPE
Synonyms CENPE; centromere protein E, 312kDa; centromere protein E (312kD); centromere-associated protein E; KIF10; PPP1R61; protein phosphatase 1; regulatory subunit 61; kinesin family member 10; kinesin-related protein CENPE; Centromere autoantigen E (312kD); protein phosphatase 1, regulatory subunit 61; CENP-E;
Gene ID 1062
mRNA Refseq NM_001813
Protein Refseq NP_001804
MIM 117143
UniProt ID Q02224

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CENPE Products

Required fields are marked with *

My Review for All CENPE Products

Required fields are marked with *

0
cart-icon