Recombinant Human CHAT protein, His-tagged
| Cat.No. : | CHAT-2464H |
| Product Overview : | Recombinant Human CHAT protein(399-748 aa), fused to His tag, was expressed in E. coli. |
| Availability | August 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 399-748 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | DNYGKTFIKKQKCSPDAFIQVALQLAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPASEKLLLLKDAIRAQTAYTVMAITGMAIDNHLLALRELARAMCKELPEMFMDETYLMSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPSQGHQP |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CHAT choline O-acetyltransferase [ Homo sapiens ] |
| Official Symbol | CHAT |
| Synonyms | CHAT; choline O-acetyltransferase; choline acetyltransferase; choline acetylase; acetyl CoA:choline O-acetyltransferase; CMS1A; CMS1A2; CHOACTASE; |
| Gene ID | 1103 |
| mRNA Refseq | NM_001142929 |
| Protein Refseq | NP_001136401 |
| MIM | 118490 |
| UniProt ID | P28329 |
| ◆ Recombinant Proteins | ||
| CHAT-1357H | Recombinant Human CHAT protein, His-tagged | +Inquiry |
| CHAT-174H | Recombinant Human CHAT | +Inquiry |
| CHAT-2464H | Recombinant Human CHAT protein, His-tagged | +Inquiry |
| CHAT-175HCL | Recombinant Human CHAT HEK293T cell lysate | +Inquiry |
| Chat-1836R | Recombinant Rat Choline O-Acetyltransferase | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHAT Products
Required fields are marked with *
My Review for All CHAT Products
Required fields are marked with *



