Recombinant Human CHAT protein, His-tagged
Cat.No. : | CHAT-2464H |
Product Overview : | Recombinant Human CHAT protein(399-748 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 399-748 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | DNYGKTFIKKQKCSPDAFIQVALQLAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPASEKLLLLKDAIRAQTAYTVMAITGMAIDNHLLALRELARAMCKELPEMFMDETYLMSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPSQGHQP |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CHAT choline O-acetyltransferase [ Homo sapiens ] |
Official Symbol | CHAT |
Synonyms | CHAT; choline O-acetyltransferase; choline acetyltransferase; choline acetylase; acetyl CoA:choline O-acetyltransferase; CMS1A; CMS1A2; CHOACTASE; |
Gene ID | 1103 |
mRNA Refseq | NM_001142929 |
Protein Refseq | NP_001136401 |
MIM | 118490 |
UniProt ID | P28329 |
◆ Recombinant Proteins | ||
CHAT-6178C | Recombinant Chicken CHAT | +Inquiry |
CHAT-2464H | Recombinant Human CHAT protein, His-tagged | +Inquiry |
CHAT-1359H | Recombinant Human CHAT protein, His&Myc-tagged | +Inquiry |
CHAT-177H | Recombinant Human CHAT protein, GST-tagged | +Inquiry |
CHAT-2666H | Recombinant Human CHAT Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHAT Products
Required fields are marked with *
My Review for All CHAT Products
Required fields are marked with *
0
Inquiry Basket