Recombinant Human CHIT1 protein, His-tagged
Cat.No. : | CHIT1-3741H |
Product Overview : | Recombinant Human CHIT1 protein(117-466 aa), fused to His tag, was expressed in E. coli. |
Availability | September 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 117-466 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLPYLPSGTPELEVPKPGQPSEPEHGPSPGQDTFCQGKADGLYPNPRERSSFYSCAGGRLFQQSCPTGLVFSNSCKCCTWN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CHIT1 chitinase 1 (chitotriosidase) [ Homo sapiens ] |
Official Symbol | CHIT1 |
Synonyms | CHIT1; chitinase 1 (chitotriosidase); chitotriosidase-1; CHI3; CHIT; chitinase-1; plasma methylumbelliferyl tetra-N-acetylchitotetraoside hydrolase; CHITD; FLJ00314; MGC125322; |
Gene ID | 1118 |
mRNA Refseq | NM_001256125 |
Protein Refseq | NP_001243054 |
MIM | 600031 |
UniProt ID | Q13231 |
◆ Recombinant Proteins | ||
CHIT1-11177H | Recombinant Human CHIT1, GST-tagged | +Inquiry |
CHIT1-3200HF | Recombinant Full Length Human CHIT1 Protein, GST-tagged | +Inquiry |
CHIT1-658H | Recombinant Human CHIT1, His tagged | +Inquiry |
CHIT1-27067TH | Recombinant Human CHIT1 | +Inquiry |
CHIT1-787H | Recombinant Human CHIT1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHIT1-2533HCL | Recombinant Human CHIT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHIT1 Products
Required fields are marked with *
My Review for All CHIT1 Products
Required fields are marked with *