Recombinant Human CHMP1B protein, GST-tagged

• Cat.No.: CHMP1B-11183H
• Product Overview: Recombinant Human CHMP1B protein(1-199 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-199 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: CHMP1B charged multivesicular body protein 1B [ Homo sapiens ]
• Official Symbol: CHMP1B
• Synonyms: CHMP1B; charged multivesicular body protein 1B; chromatin modifying protein 1B; charged multivesicular body protein 1b; C18orf2; CHMP1.5; Vps46B; vacuolar protein sorting 46-2; chromatin-modifying protein 1b; vacuolar protein sorting-associated protein 46-2; C10orf2; Vps46-2; C18-ORF2; hVps46-2
• Gene ID: 57132
• mRNA Refseq: NM_020412
• Protein Refseq: NP_065145
• MIM: 606486
• UniProt ID: Q7LBR1