Recombinant Human CHMP1B protein, GST-tagged
| Cat.No. : | CHMP1B-11183H |
| Product Overview : | Recombinant Human CHMP1B protein(1-199 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | January 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-199 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CHMP1B charged multivesicular body protein 1B [ Homo sapiens ] |
| Official Symbol | CHMP1B |
| Synonyms | CHMP1B; charged multivesicular body protein 1B; chromatin modifying protein 1B; charged multivesicular body protein 1b; C18orf2; CHMP1.5; Vps46B; vacuolar protein sorting 46-2; chromatin-modifying protein 1b; vacuolar protein sorting-associated protein 46-2; C10orf2; Vps46-2; C18-ORF2; hVps46-2; |
| Gene ID | 57132 |
| mRNA Refseq | NM_020412 |
| Protein Refseq | NP_065145 |
| MIM | 606486 |
| UniProt ID | Q7LBR1 |
| ◆ Recombinant Proteins | ||
| CHMP1B-3404M | Recombinant Mouse CHMP1B Protein | +Inquiry |
| CHMP1B-1570C | Recombinant Chicken CHMP1B | +Inquiry |
| CHMP1B-6794H | Recombinant Human CHMP1B protein, His-tagged | +Inquiry |
| CHMP1B-10373Z | Recombinant Zebrafish CHMP1B | +Inquiry |
| CHMP1B-848R | Recombinant Rhesus monkey CHMP1B Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHMP1B-7533HCL | Recombinant Human CHMP1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHMP1B Products
Required fields are marked with *
My Review for All CHMP1B Products
Required fields are marked with *
