Recombinant Human CHMP1B Protein, GST-Tagged
Cat.No. : | CHMP1B-1247H |
Product Overview : | Human CHMP1B full-length ORF (NP_065145.2, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CHMP1B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 48.5 kDa |
AA Sequence : | MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHMP1B charged multivesicular body protein 1B [ Homo sapiens ] |
Official Symbol | CHMP1B |
Synonyms | CHMP1B; charged multivesicular body protein 1B; chromatin modifying protein 1B; charged multivesicular body protein 1b; C18orf2; CHMP1.5; Vps46B; vacuolar protein sorting 46-2; chromatin-modifying protein 1b; vacuolar protein sorting-associated protein 46-2; C10orf2; Vps46-2; C18-ORF2; hVps46-2; |
Gene ID | 57132 |
mRNA Refseq | NM_020412 |
Protein Refseq | NP_065145 |
MIM | 606486 |
UniProt ID | Q7LBR1 |
◆ Recombinant Proteins | ||
CHMP1B-6794H | Recombinant Human Charged Multivesicular Body Protein 1B, His-tagged | +Inquiry |
CHMP1B-11183H | Recombinant Human CHMP1B, GST-tagged | +Inquiry |
CHMP1B-1570C | Recombinant Chicken CHMP1B | +Inquiry |
CHMP1B-1649M | Recombinant Mouse CHMP1B Protein, His (Fc)-Avi-tagged | +Inquiry |
CHMP1B-3204HF | Recombinant Full Length Human CHMP1B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHMP1B-7533HCL | Recombinant Human CHMP1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHMP1B Products
Required fields are marked with *
My Review for All CHMP1B Products
Required fields are marked with *