Recombinant Human CHMP1B Protein, GST-Tagged

Cat.No. : CHMP1B-1247H
Product Overview : Human CHMP1B full-length ORF (NP_065145.2, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CHMP1B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008]
Molecular Mass : 48.5 kDa
AA Sequence : MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHMP1B charged multivesicular body protein 1B [ Homo sapiens ]
Official Symbol CHMP1B
Synonyms CHMP1B; charged multivesicular body protein 1B; chromatin modifying protein 1B; charged multivesicular body protein 1b; C18orf2; CHMP1.5; Vps46B; vacuolar protein sorting 46-2; chromatin-modifying protein 1b; vacuolar protein sorting-associated protein 46-2; C10orf2; Vps46-2; C18-ORF2; hVps46-2;
Gene ID 57132
mRNA Refseq NM_020412
Protein Refseq NP_065145
MIM 606486
UniProt ID Q7LBR1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHMP1B Products

Required fields are marked with *

My Review for All CHMP1B Products

Required fields are marked with *

0
cart-icon
0
compare icon