Recombinant Human CHST4 Protein, GST-tagged
Cat.No. : | CHST4-1344H |
Product Overview : | Human CHST4 full-length ORF ( AAH35282, 1 a.a. - 370 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an N-acetylglucosamine 6-O sulfotransferase. The encoded enzyme transfers sulfate from 3'phosphoadenosine 5'phospho-sulfate to the 6-hydroxyl group of N-acetylglucosamine on glycoproteins. This protein is localized to the Golgi and is involved in the modification of glycan structures on ligands of the lymphocyte homing receptor L-selectin. Alternate splicing in the 5' UTR results in multiple transcript variants that encode the same protein. [provided by RefSeq, Oct 2009] |
Molecular Mass : | 66.44 kDa |
AA Sequence : | MAILALFFHMYSHNISSLSMKAQPERMHVLVLSSWRSGSSFVGQLFGQHPDVFYLMEPAWHVWMTFKQSTAWMLHMAVRDLIRAVFLCDMSVFDAYMEPGPRRQSSLFQWENSRALCSAPACDIIPQDEIIPRAHCRLLCSQQPFEVVEKACRSYSHVVLKEVRFFNLQSLYPLLKDPSLNLHIVHLVRDPRAVFRSRERTKGDLMIDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAPVAQTSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKACGDAMNLLGYRHVRSEQEQRNLLLDLLSTWTVPEQIH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHST4 carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4 [ Homo sapiens ] |
Official Symbol | CHST4 |
Synonyms | CHST4; carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4; carbohydrate sulfotransferase 4; HEC GLCNAC 6 ST; LSST; GST-3; gn6st-2; glcNAc6ST-2; HEC-GlcNAc6ST; L-selectin ligand sulfotransferase; N-acetylglucosamine 6-O-sulfotransferase 2; high endothelial cells N-acetylglucosamine 6-O-sulfotransferase; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 3; galactose/N-acetylglucosamine/N-acetylgalactosamine 6-O-sulfotransferase 3; GST3; GlcNAc6ST2; HECGLCNAC6ST; |
Gene ID | 10164 |
mRNA Refseq | NM_001166395 |
Protein Refseq | NP_001159867 |
UniProt ID | Q8NCG5 |
◆ Recombinant Proteins | ||
CHST4-1835HF | Recombinant Full Length Human CHST4 Protein, GST-tagged | +Inquiry |
CHST4-3453M | Recombinant Mouse CHST4 Protein | +Inquiry |
CHST4-1676M | Recombinant Mouse CHST4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHST4-1344H | Recombinant Human CHST4 Protein, GST-tagged | +Inquiry |
CHST4-561H | Active Recombinant Human CHST4 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHST4 Products
Required fields are marked with *
My Review for All CHST4 Products
Required fields are marked with *