Recombinant Human CHUK Protein, GST-tagged
Cat.No. : | CHUK-1351H |
Product Overview : | Human CHUK partial ORF ( NP_001269, 646 a.a. - 745 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | RQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHUK conserved helix-loop-helix ubiquitous kinase [ Homo sapiens ] |
Official Symbol | CHUK |
Synonyms | CHUK; conserved helix-loop-helix ubiquitous kinase; TCF16; inhibitor of nuclear factor kappa-B kinase subunit alpha; IkBKA; IKK alpha; IKK1; IKKA; NFKBIKA; TCF-16; IKK-a kinase; I-kappa-B kinase 1; I-kappa-B kinase-alpha; transcription factor 16; IkB kinase alpha subunit; Nuclear factor NFkappaB inhibitor kinase alpha; IKBKA; IKK-alpha; |
Gene ID | 1147 |
mRNA Refseq | NM_001278 |
Protein Refseq | NP_001269 |
MIM | 600664 |
UniProt ID | O15111 |
◆ Recombinant Proteins | ||
CHUK-3422HF | Active Recombinant Full Length Human CHUK Protein, GST-tagged | +Inquiry |
CHUK-7671HF | Active Recombinant Full Length Human CHUK Protein, DDK-tagged, Biotinylated | +Inquiry |
CHUK-2119C | Recombinant Chicken CHUK | +Inquiry |
CHUK-5129H | Active Recombinant Human CHUK Protein, GST-tagged | +Inquiry |
CHUK-1351H | Recombinant Human CHUK Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHUK Products
Required fields are marked with *
My Review for All CHUK Products
Required fields are marked with *