Recombinant Human CHUK Protein, GST-tagged

Cat.No. : CHUK-1351H
Product Overview : Human CHUK partial ORF ( NP_001269, 646 a.a. - 745 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.63 kDa
AA Sequence : RQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHUK conserved helix-loop-helix ubiquitous kinase [ Homo sapiens ]
Official Symbol CHUK
Synonyms CHUK; conserved helix-loop-helix ubiquitous kinase; TCF16; inhibitor of nuclear factor kappa-B kinase subunit alpha; IkBKA; IKK alpha; IKK1; IKKA; NFKBIKA; TCF-16; IKK-a kinase; I-kappa-B kinase 1; I-kappa-B kinase-alpha; transcription factor 16; IkB kinase alpha subunit; Nuclear factor NFkappaB inhibitor kinase alpha; IKBKA; IKK-alpha;
Gene ID 1147
mRNA Refseq NM_001278
Protein Refseq NP_001269
MIM 600664
UniProt ID O15111

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHUK Products

Required fields are marked with *

My Review for All CHUK Products

Required fields are marked with *

0
cart-icon