Recombinant Human CISD2 protein, GST-tagged
Cat.No. : | CISD2-301649H |
Product Overview : | Recombinant Human CISD2 (61-135 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Pro61-Val135 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | CISD2 CDGSH iron sulfur domain 2 [ Homo sapiens (human) ] |
Official Symbol | CISD2 |
Synonyms | ERIS; WFS2; ZCD2; NAF-1; Miner1 |
Gene ID | 493856 |
mRNA Refseq | NM_001008388 |
Protein Refseq | NP_001008389 |
MIM | 611507 |
UniProt ID | Q8N5K1 |
◆ Recombinant Proteins | ||
CISD2-3482M | Recombinant Mouse CISD2 Protein | +Inquiry |
CISD2-301649H | Recombinant Human CISD2 protein, GST-tagged | +Inquiry |
CISD2-10698Z | Recombinant Zebrafish CISD2 | +Inquiry |
CISD2-1379H | Recombinant Human CISD2 Protein, GST-tagged | +Inquiry |
CISD2-11254H | Recombinant Human CISD2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CISD2-7489HCL | Recombinant Human CISD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CISD2 Products
Required fields are marked with *
My Review for All CISD2 Products
Required fields are marked with *
0
Inquiry Basket