Recombinant Full Length Lithobates Catesbeiana Cdgsh Iron-Sulfur Domain-Containing Protein 2(Cisd2) Protein, His-Tagged
| Cat.No. : | RFL33223LF |
| Product Overview : | Recombinant Full Length Lithobates catesbeiana CDGSH iron-sulfur domain-containing protein 2(cisd2) Protein (C1C524) (1-135aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Lithobates catesbeiana (American bullfrog) (Rana catesbeiana) |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-135) |
| Form : | Lyophilized powder |
| AA Sequence : | MVLEILARVIKVQLPAYLKRLPVPDSIAGFIRLTVSEWLRLLPFLGVLALLGYLAIRPFLPKKKQQKDSLINLKIQKENPKVVNEIDIEDLRIAKVAYCRCWRSKTFPVCDGSHNKHNELTGDNVGPLILKKKEV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | cisd2 |
| Synonyms | cisd2; CDGSH iron-sulfur domain-containing protein 2 |
| UniProt ID | C1C524 |
| ◆ Recombinant Proteins | ||
| CISD2-301649H | Recombinant Human CISD2 protein, GST-tagged | +Inquiry |
| CISD2-1379H | Recombinant Human CISD2 Protein, GST-tagged | +Inquiry |
| CISD2-11254H | Recombinant Human CISD2 protein, His-tagged | +Inquiry |
| RFL33223LF | Recombinant Full Length Lithobates Catesbeiana Cdgsh Iron-Sulfur Domain-Containing Protein 2(Cisd2) Protein, His-Tagged | +Inquiry |
| CISD2-1855HF | Recombinant Full Length Human CISD2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CISD2-7489HCL | Recombinant Human CISD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All cisd2 Products
Required fields are marked with *
My Review for All cisd2 Products
Required fields are marked with *



