Recombinant Human CLASP1 protein, His-tagged
Cat.No. : | CLASP1-088H |
Product Overview : | Recombinant Human CLASP1 protein(NP_001135745)(1-238 aa), fused to His tag, was expressed in E. coli. |
Availability | June 27, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-238 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MEPRMESCLAQVLQKDVGKRLQVGQELIDYFSDKQKSADLEHDQTMLDKLVDGLATSWVNSSNYKVVLLGMDILSALVTRLQDRFKAQIGTVLPSLIDRLGDAKDSVREQDQTLLLKIMDQAANPQYVWDRMLGGFKHKNFRTREGICLCLIATLNASGAQTLTLSKIVPHICNLLGDPNSQVRDAAINSLVEIYRHVGERVRADLSKKGLPQSRLNVIFTKFDEVQKSGNMIQSAND |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | CLASP1 cytoplasmic linker associated protein 1 [ Homo sapiens ] |
Official Symbol | CLASP1 |
Synonyms | CLASP1; cytoplasmic linker associated protein 1; CLIP-associating protein 1; KIAA0622; MAST1; multiple asters 1; protein Orbit homolog 1; multiple asters homolog 1; cytoplasmic linker-associated protein 1; FLJ33821; FLJ41222; MGC131895; DKFZp686D1968; DKFZp686H2039; |
Gene ID | 23332 |
mRNA Refseq | NM_001142273 |
Protein Refseq | NP_001135745 |
MIM | 605852 |
UniProt ID | Q7Z460 |
◆ Recombinant Proteins | ||
CLASP1-1406H | Recombinant Human CLASP1 Protein, GST-tagged | +Inquiry |
CLASP1-088H | Recombinant Human CLASP1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLASP1-188HCL | Recombinant Human CLASP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLASP1 Products
Required fields are marked with *
My Review for All CLASP1 Products
Required fields are marked with *