Recombinant Human CLASP1 protein, His-tagged
| Cat.No. : | CLASP1-088H |
| Product Overview : | Recombinant Human CLASP1 protein(1-238 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | January 16, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-238 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MEPRMESCLAQVLQKDVGKRLQVGQELIDYFSDKQKSADLEHDQTMLDKLVDGLATSWVNSSNYKVVLLGMDILSALVTRLQDRFKAQIGTVLPSLIDRLGDAKDSVREQDQTLLLKIMDQAANPQYVWDRMLGGFKHKNFRTREGICLCLIATLNASGAQTLTLSKIVPHICNLLGDPNSQVRDAAINSLVEIYRHVGERVRADLSKKGLPQSRLNVIFTKFDEVQKSGNMIQSAND |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CLASP1 cytoplasmic linker associated protein 1 [ Homo sapiens ] |
| Official Symbol | CLASP1 |
| Synonyms | CLASP1; cytoplasmic linker associated protein 1; CLIP-associating protein 1; KIAA0622; MAST1; multiple asters 1; protein Orbit homolog 1; multiple asters homolog 1; cytoplasmic linker-associated protein 1; FLJ33821; FLJ41222; MGC131895; DKFZp686D1968; DKFZp686H2039; |
| Gene ID | 23332 |
| mRNA Refseq | NM_001142273 |
| Protein Refseq | NP_001135745 |
| MIM | 605852 |
| UniProt ID | Q7Z460 |
| ◆ Recombinant Proteins | ||
| CLASP1-088H | Recombinant Human CLASP1 protein, His-tagged | +Inquiry |
| CLASP1-1406H | Recombinant Human CLASP1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLASP1-112HKCL | Human CLASP1 Knockdown Cell Lysate | +Inquiry |
| CLASP1-188HCL | Recombinant Human CLASP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLASP1 Products
Required fields are marked with *
My Review for All CLASP1 Products
Required fields are marked with *
