Recombinant Human CLC Protein, GST-tagged
Cat.No. : | CLC-1408H |
Product Overview : | Human CLC partial ORF ( NP_001819.2, 52 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to glycerophosphocholine and a free fatty acid. This protein may possess carbohydrate or IgE-binding activities. It is both structurally and functionally related to the galectin family of beta-galactoside binding proteins. It may be associated with inflammation and some myeloid leukemias. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 35.75 kDa |
AA Sequence : | FHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLC Charcot-Leyden crystal protein [ Homo sapiens ] |
Official Symbol | CLC |
Synonyms | CLC; Charcot-Leyden crystal protein; eosinophil lysophospholipase; galectin 10; LGALS10; LPPL_HUMAN; lysolecithin acylhydrolase; MGC149659; galectin-10; GAL10; Gal-10; LGALS10A; |
Gene ID | 1178 |
mRNA Refseq | NM_001828 |
Protein Refseq | NP_001819 |
MIM | 153310 |
UniProt ID | Q05315 |
◆ Recombinant Proteins | ||
CLC-1408H | Recombinant Human CLC Protein, GST-tagged | +Inquiry |
CLC-13H | Recombinant Human CLC Protein (Ser2-Arg142), N-His tagged, Animal-free, Carrier-free | +Inquiry |
CLC-616H | Recombinant Human CLC Protein, His-tagged | +Inquiry |
CLC-1741H | Recombinant Human CLC Protein (Ser2-Arg142), His tagged | +Inquiry |
CLC-28114TH | Recombinant Human CLC, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLC-7479HCL | Recombinant Human CLC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLC Products
Required fields are marked with *
My Review for All CLC Products
Required fields are marked with *
0
Inquiry Basket