Recombinant Human CLCN7 Protein, GST-tagged
Cat.No. : | CLCN7-1422H |
Product Overview : | Human CLCN7 partial ORF ( NP_001278, 706 a.a. - 805 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The product of this gene belongs to the CLC chloride channel family of proteins. Chloride channels play important roles in the plasma membrane and in intracellular organelles. This gene encodes chloride channel 7. Defects in this gene are the cause of osteopetrosis autosomal recessive type 4 (OPTB4), also called infantile malignant osteopetrosis type 2 as well as the cause of autosomal dominant osteopetrosis type 2 (OPTA2), also called autosomal dominant Albers-Schonberg disease or marble disease autosoml dominant. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. OPTA2 is the most common form of osteopetrosis, occurring in adolescence or adulthood. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | LRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNRNQVVGLVTRKDLARYRLGKRGLEELSLAQT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLCN7 chloride channel, voltage-sensitive 7 [ Homo sapiens ] |
Official Symbol | CLCN7 |
Synonyms | CLCN7; chloride channel, voltage-sensitive 7; chloride channel 7; H(+)/Cl(-) exchange transporter 7; CLC 7; ClC 7; CLC7; OPTA2; PPP1R63; protein phosphatase 1; regulatory subunit 63; chloride channel protein 7; protein phosphatase 1, regulatory subunit 63; CLC-7; OPTB4; FLJ26686; FLJ39644; FLJ46423; |
Gene ID | 1186 |
mRNA Refseq | NM_001114331 |
Protein Refseq | NP_001107803 |
MIM | 602727 |
UniProt ID | P51798 |
◆ Recombinant Proteins | ||
CLCN7-11280H | Recombinant Human CLCN7, GST-tagged | +Inquiry |
CLCN7-4750Z | Recombinant Zebrafish CLCN7 | +Inquiry |
CLCN7-3518M | Recombinant Mouse CLCN7 Protein | +Inquiry |
CLCN7-1428R | Recombinant Rat CLCN7 Protein | +Inquiry |
CLCN7-2351C | Recombinant Chicken CLCN7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLCN7-7472HCL | Recombinant Human CLCN7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLCN7 Products
Required fields are marked with *
My Review for All CLCN7 Products
Required fields are marked with *
0
Inquiry Basket