Recombinant Human CLDN2
Cat.No. : | CLDN2-26706TH |
Product Overview : | Recombinant fragment of HumanClaudin 2 with a proprietary tag: predicted molecular weight 31.35 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 52 amino acids |
Description : | This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5 untranslated region have been found for this gene. |
Molecular Weight : | 31.350kDa inclusive of tags |
Biological activity : | Useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAA |
Sequence Similarities : | Belongs to the claudin family. |
Gene Name | CLDN2 claudin 2 [ Homo sapiens ] |
Official Symbol | CLDN2 |
Synonyms | CLDN2; claudin 2; claudin-2; |
Gene ID | 9075 |
mRNA Refseq | NM_001171092 |
Protein Refseq | NP_001164563 |
MIM | 300520 |
Uniprot ID | P57739 |
Chromosome Location | Xq22.3-q23 |
Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
Function | identical protein binding; structural molecule activity; |
◆ Recombinant Proteins | ||
CLDN2-2948H | Active Recombinant Human CLDN2 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
CLDN2-1438H | Recombinant Human CLDN2 Protein, GST-tagged | +Inquiry |
CLDN2-11292H | Recombinant Human CLDN2 protein(184-230 aa), GST-tagged | +Inquiry |
CLDN2-06HFL | Recombinant Full Length Human claudin 2 Protein, Flag tagged | +Inquiry |
CLDN2-2052HF | Recombinant Full Length Human CLDN2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN2-7466HCL | Recombinant Human CLDN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN2 Products
Required fields are marked with *
My Review for All CLDN2 Products
Required fields are marked with *
0
Inquiry Basket