Recombinant Human CLDN22 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | CLDN22-142H |
Product Overview : | CLDN22 MS Standard C13 and N15-labeled recombinant protein (NP_001104789) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is intronless and overlaps the 3' UTR of the WWC2 gene (GeneID: 80014) on the opposite strand. |
Molecular Mass : | 24.3 kDa |
AA Sequence : | MALVFRTVAQLAGVSLSLLGWVLSCLTNYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEVGMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGESQRDLKRRLLILGGILSWASGVTALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGGCLLHCAACSSHAPLASGHYAVAQTQDHHQELETRNTNLKHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CLDN22 claudin 22 [ Homo sapiens (human) ] |
Official Symbol | CLDN22 |
Synonyms | CLDN22; claudin 22; CLDN21; claudin-22 |
Gene ID | 53842 |
mRNA Refseq | NM_001111319 |
Protein Refseq | NP_001104789 |
UniProt ID | Q8N7P3 |
◆ Recombinant Proteins | ||
RFL3310HF | Recombinant Full Length Human Claudin-22(Cldn22) Protein, His-Tagged | +Inquiry |
CLDN22-1731M | Recombinant Mouse CLDN22 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLDN22-159HFL | Recombinant Full Length Human CLDN22 Protein, C-Flag-tagged | +Inquiry |
CLDN22-894R | Recombinant Rhesus monkey CLDN22 Protein, His-tagged | +Inquiry |
CLDN22-142H | Recombinant Human CLDN22 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN22 Products
Required fields are marked with *
My Review for All CLDN22 Products
Required fields are marked with *