Recombinant Human CLDN3 protein, His-B2M-tagged
Cat.No. : | CLDN3-2700H |
Product Overview : | Recombinant Human CLDN3 protein(O15551)(30-80aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 30-80aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.7 kDa |
AA Sequence : | RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CLDN3 claudin 3 [ Homo sapiens ] |
Official Symbol | CLDN3 |
Synonyms | CLDN3; claudin 3; C7orf1, CPETR2; claudin-3; Clostridium perfringens enterotoxin receptor 2; CPE R2; CPE receptor 2; HRVP1; RVP1; ventral prostate.1 like protein; CPE-R 2; CPE-receptor 2; ventral prostate.1-like protein; ventral prostate.1 protein homolog; C7orf1; CPE-R2; CPETR2; |
Gene ID | 1365 |
mRNA Refseq | NM_001306 |
Protein Refseq | NP_001297 |
MIM | 602910 |
UniProt ID | O15551 |
◆ Recombinant Proteins | ||
RFL4935HF | Recombinant Full Length Human Claudin-3(Cldn3) Protein, His-Tagged | +Inquiry |
CLDN3-84HF | Recombinant Full Length Human CLDN3 Protein | +Inquiry |
CLDN3-895R | Recombinant Rhesus monkey CLDN3 Protein, His-tagged | +Inquiry |
CLDN3-5776C | Recombinant Chicken CLDN3 | +Inquiry |
CLDN3-1537H | Recombinant Human CLDN3 Full Length Transmembrane protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN3-7463HCL | Recombinant Human CLDN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLDN3 Products
Required fields are marked with *
My Review for All CLDN3 Products
Required fields are marked with *
0
Inquiry Basket