Recombinant Human CLEC10A Protein
Cat.No. : | CLEC10A-1450H |
Product Overview : | Human CLEC10A full-length ORF (NP_878910.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Form : | Liquid |
Molecular Mass : | 35.4 kDa |
AA Sequence : | MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | CLEC10A C-type lectin domain family 10, member A [ Homo sapiens ] |
Official Symbol | CLEC10A |
Synonyms | CLEC10A; C-type lectin domain family 10, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 14 (macrophage derived) , CLECSF13, CLECSF14; C-type lectin domain family 10 member A; CD301; HML; HML2; macrophage lectin 2 (calcium dependent); C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 13 (macrophage-derived); C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 14 (macrophage-derived); MGL; CLECSF13; CLECSF14; |
Gene ID | 10462 |
mRNA Refseq | NM_006344 |
Protein Refseq | NP_006335 |
MIM | 605999 |
UniProt ID | Q8IUN9 |
◆ Recombinant Proteins | ||
CLEC10A-3904H | Recombinant Human CLEC10A Protein (Gln61-Asn292), N-Fc tagged | +Inquiry |
CLEC10A-1688H | Recombinant Human CLEC10A Protein (Gln61-His316), C-His tagged | +Inquiry |
CLEC10A-308H | Recombinant Human CLEC10A protein, His-tagged | +Inquiry |
CLEC10A-1856H | Recombinant Human CLEC10A protein, His & T7-tagged | +Inquiry |
CLEC10A-1698R | Recombinant Rhesus Monkey CLEC10A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC10A-1456HCL | Recombinant Human CLEC10A cell lysate | +Inquiry |
CLEC10A-1730MCL | Recombinant Mouse CLEC10A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC10A Products
Required fields are marked with *
My Review for All CLEC10A Products
Required fields are marked with *