Recombinant Human CLEC10A Protein, MYC/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CLEC10A-306H |
| Product Overview : | CLEC10A MS Standard C13 and N15-labeled recombinant protein (NP_006335) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 32.7 kDa |
| AA Sequence : | MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAVHSEMLLRVQQLVQDLKKLTCQVATLNNNGEEASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CLEC10A C-type lectin domain family 10, member A [ Homo sapiens (human) ] |
| Official Symbol | CLEC10A |
| Synonyms | CLEC10A; C-type lectin domain family 10, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 14 (macrophage derived), CLECSF13, CLECSF14; C-type lectin domain family 10 member A; CD301; HML; HML2; macrophage lectin 2 (calcium dependent); C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 13 (macrophage-derived); C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 14 (macrophage-derived); MGL; CLECSF13; CLECSF14; |
| Gene ID | 10462 |
| mRNA Refseq | NM_006344 |
| Protein Refseq | NP_006335 |
| MIM | 605999 |
| UniProt ID | Q8IUN9 |
| ◆ Recombinant Proteins | ||
| CLEC10A-7800H | Recombinant Human CLEC10A, His-tagged | +Inquiry |
| Clec10a-6909M | Recombinant Mouse Clec10a protein(Gln58-Ser305), His-tagged | +Inquiry |
| CLEC10A-1451H | Recombinant Human CLEC10A Protein, GST-tagged | +Inquiry |
| CLEC10A-1688H | Recombinant Human CLEC10A Protein (Gln61-His316), C-His tagged | +Inquiry |
| CLEC10A-3238H | Recombinant Human CLEC10A Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLEC10A-1456HCL | Recombinant Human CLEC10A cell lysate | +Inquiry |
| CLEC10A-1730MCL | Recombinant Mouse CLEC10A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC10A Products
Required fields are marked with *
My Review for All CLEC10A Products
Required fields are marked with *




