Recombinant Human CLEC11A Protein, T7-His-TEV-tagged

• Cat.No.: CLEC11A-001H
• Product Overview: Full-length extracellular domain of human CLEC11A cDNA (22 – 323 aa, derived from BC005810) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Description: This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined.
• Form: Liquid
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
• Purity: > 90% by SDS-PAGE.
• Applications: 1. May be used for in vitro -glycosylated CLEC11A protein mediated HSC regulation study with this protein as either coating matrix protein or as soluble factor.
  2. May be used for CLEC11A protein – protein interaction assay.
  3. May be used as enzymatic substrate for various proteases.
  4. May be used for specific antibody production.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
• Concentration: 0.5 mg/ml
• Storage Buffer: Sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.

Gene Information

• Gene Name: CLEC11A
• Official Symbol: CLEC11A C-type lectin domain containing 11A [ Homo sapiens (human) ]
• Synonyms: CLEC11A; C-type lectin domain containing 11A; P47; SCGF; LSLCL; CLECSF3; C-type lectin domain family 11 member A; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 3; C-type lectin superfamily member 3; lymphocyte secreted C-type lectin; lymphocyte secreted long form of C-type lectin; osteolectin; stem cell growth factor; stem cell growth factor; lymphocyte secreted C-type lectin
• Gene ID: 6320
• mRNA Refseq: NM_002975
• Protein Refseq: NP_002966
• MIM: 604713
• UniProt ID: Q9Y240