Recombinant Human CLEC11A Protein, T7-His-TEV-tagged

Cat.No. : CLEC11A-001H
Product Overview : Full-length extracellular domain of human CLEC11A cDNA (22 – 323 aa, derived from BC005810) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Description : This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined.
Form : Liquid
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
Purity : > 90% by SDS-PAGE.
Applications : 1. May be used for in vitro -glycosylated CLEC11A protein mediated HSC regulation study with this protein as either coating matrix protein or as soluble factor.
2. May be used for CLEC11A protein – protein interaction assay.
3. May be used as enzymatic substrate for various proteases.
4. May be used for specific antibody production.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Concentration : 0.5 mg/ml
Storage Buffer : Sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
Gene Name CLEC11A
Official Symbol CLEC11A C-type lectin domain containing 11A [ Homo sapiens (human) ]
Synonyms CLEC11A; C-type lectin domain containing 11A; P47; SCGF; LSLCL; CLECSF3; C-type lectin domain family 11 member A; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 3; C-type lectin superfamily member 3; lymphocyte secreted C-type lectin; lymphocyte secreted long form of C-type lectin; osteolectin; stem cell growth factor; stem cell growth factor; lymphocyte secreted C-type lectin
Gene ID 6320
mRNA Refseq NM_002975
Protein Refseq NP_002966
MIM 604713
UniProt ID Q9Y240

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CLEC11A Products

Required fields are marked with *

My Review for All CLEC11A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon