Recombinant Human CLEC11A Protein, T7-His-TEV-tagged
| Cat.No. : | CLEC11A-001H |
| Product Overview : | Full-length extracellular domain of human CLEC11A cDNA (22 – 323 aa, derived from BC005810) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified. |
| Availability | January 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Description : | This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined. |
| Form : | Liquid |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF |
| Purity : | > 90% by SDS-PAGE. |
| Applications : | 1. May be used for in vitro -glycosylated CLEC11A protein mediated HSC regulation study with this protein as either coating matrix protein or as soluble factor. 2. May be used for CLEC11A protein – protein interaction assay. 3. May be used as enzymatic substrate for various proteases. 4. May be used for specific antibody production. |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Concentration : | 0.5 mg/ml |
| Storage Buffer : | Sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Gene Name | CLEC11A |
| Official Symbol | CLEC11A C-type lectin domain containing 11A [ Homo sapiens (human) ] |
| Synonyms | CLEC11A; C-type lectin domain containing 11A; P47; SCGF; LSLCL; CLECSF3; C-type lectin domain family 11 member A; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 3; C-type lectin superfamily member 3; lymphocyte secreted C-type lectin; lymphocyte secreted long form of C-type lectin; osteolectin; stem cell growth factor; stem cell growth factor; lymphocyte secreted C-type lectin |
| Gene ID | 6320 |
| mRNA Refseq | NM_002975 |
| Protein Refseq | NP_002966 |
| MIM | 604713 |
| UniProt ID | Q9Y240 |
| ◆ Recombinant Proteins | ||
| CLEC11A-1095R | Recombinant Rat CLEC11A Protein, His (Fc)-Avi-tagged | +Inquiry |
| CLEC11A-1453H | Recombinant Human CLEC11A Protein, GST-tagged | +Inquiry |
| CLEC11A-30961TH | Recombinant Human CLEC11A | +Inquiry |
| CLEC11A-1409H | Recombinant Human C-type Lectin Domain Family 11, Member A | +Inquiry |
| Clec11a-1050M | Active Recombinant Mouse Clec11a Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC11A Products
Required fields are marked with *
My Review for All CLEC11A Products
Required fields are marked with *
