Recombinant Human CLEC2D Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CLEC2D-6077H |
| Product Overview : | CLEC2D MS Standard C13 and N15-labeled recombinant protein (NP_001004419) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene. |
| Molecular Mass : | 22.1 kDa |
| AA Sequence : | MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQLVMKEDGANLYVAKVSQVPRMNPRPVMVSYPGSRRVCLFETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CLEC2D C-type lectin domain family 2 member D [ Homo sapiens (human) ] |
| Official Symbol | CLEC2D |
| Synonyms | CLEC2D; C-type lectin domain family 2, member D; C type lectin superfamily 2, member D; C-type lectin domain family 2 member D; C type lectin related f; CLAX; lectin like transcript 1; LLT1; OCIL; LLT-1; C-type lectin related f; lectin-like transcript 1; lectin-like NK cell receptor; osteoclast inhibitory lectin; C-type lectin superfamily 2, member D; |
| Gene ID | 29121 |
| mRNA Refseq | NM_001004419 |
| Protein Refseq | NP_001004419 |
| MIM | 605659 |
| UniProt ID | Q9UHP7 |
| ◆ Recombinant Proteins | ||
| CLEC2D-1438R | Recombinant Rat CLEC2D Protein | +Inquiry |
| Clec2d-7853M | Recombinant Mouse Clec2d protein, His-tagged | +Inquiry |
| CLEC2D-329HB | Recombinant Human CLEC2D protein, hFc-Avi-tagged, Biotinylated | +Inquiry |
| CLEC2D-612HFL | Recombinant Full Length Human CLEC2D Protein, C-Flag-tagged | +Inquiry |
| CLEC2D-3236H | Recombinant Human CLEC2D Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLEC2D-737RCL | Recombinant Rat CLEC2D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC2D Products
Required fields are marked with *
My Review for All CLEC2D Products
Required fields are marked with *
