Recombinant Human CLEC2D Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CLEC2D-6077H
Product Overview : CLEC2D MS Standard C13 and N15-labeled recombinant protein (NP_001004419) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene.
Molecular Mass : 22.1 kDa
AA Sequence : MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQLVMKEDGANLYVAKVSQVPRMNPRPVMVSYPGSRRVCLFETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CLEC2D C-type lectin domain family 2 member D [ Homo sapiens (human) ]
Official Symbol CLEC2D
Synonyms CLEC2D; C-type lectin domain family 2, member D; C type lectin superfamily 2, member D; C-type lectin domain family 2 member D; C type lectin related f; CLAX; lectin like transcript 1; LLT1; OCIL; LLT-1; C-type lectin related f; lectin-like transcript 1; lectin-like NK cell receptor; osteoclast inhibitory lectin; C-type lectin superfamily 2, member D;
Gene ID 29121
mRNA Refseq NM_001004419
Protein Refseq NP_001004419
MIM 605659
UniProt ID Q9UHP7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLEC2D Products

Required fields are marked with *

My Review for All CLEC2D Products

Required fields are marked with *

0
cart-icon
0
compare icon