Recombinant Human CLECL1 protein, His & Myc-tagged
Cat.No. : | CLECL1-2383H |
Product Overview : | Recombinant Human CLECL1 protein(Q8IZS7)(89-167aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 89-167aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 13 kDa |
AA Sequence : | KTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CLECL1 C-type lectin-like 1 [ Homo sapiens ] |
Official Symbol | CLECL1 |
Synonyms | CLECL1; C-type lectin-like 1; C-type lectin-like domain family 1; DCAL1; dendritic cell associated lectin 1; DCAL-1; DC-associated lectin-1; dendritic cell-associated lectin 1; dendritic cell-associated lectin-1; type II transmembrane protein DCAL1; |
Gene ID | 160365 |
mRNA Refseq | NM_001253748 |
Protein Refseq | NP_001240677 |
MIM | 607467 |
UniProt ID | Q8IZS7 |
◆ Recombinant Proteins | ||
CLECL1-02H | Recombinant Human CLECL1 Protein, N-His tagged | +Inquiry |
CLECL1-2382H | Recombinant Human CLECL1 Protein, GST-tagged | +Inquiry |
CLECL1-2383H | Recombinant Human CLECL1 protein, His & Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLECL1 Products
Required fields are marked with *
My Review for All CLECL1 Products
Required fields are marked with *
0
Inquiry Basket