Recombinant Human CLECL1 protein, His & Myc-tagged

Cat.No. : CLECL1-2383H
Product Overview : Recombinant Human CLECL1 protein(Q8IZS7)(89-167aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His&Myc
Protein Length : 89-167aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 13 kDa
AA Sequence : KTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CLECL1 C-type lectin-like 1 [ Homo sapiens ]
Official Symbol CLECL1
Synonyms CLECL1; C-type lectin-like 1; C-type lectin-like domain family 1; DCAL1; dendritic cell associated lectin 1; DCAL-1; DC-associated lectin-1; dendritic cell-associated lectin 1; dendritic cell-associated lectin-1; type II transmembrane protein DCAL1;
Gene ID 160365
mRNA Refseq NM_001253748
Protein Refseq NP_001240677
MIM 607467
UniProt ID Q8IZS7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLECL1 Products

Required fields are marked with *

My Review for All CLECL1 Products

Required fields are marked with *

0
cart-icon