Recombinant Human CLECL1 protein, His & Myc-tagged
| Cat.No. : | CLECL1-2383H |
| Product Overview : | Recombinant Human CLECL1 protein(Q8IZS7)(89-167aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His&Myc |
| Protein Length : | 89-167aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 13 kDa |
| AA Sequence : | KTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CLECL1 C-type lectin-like 1 [ Homo sapiens ] |
| Official Symbol | CLECL1 |
| Synonyms | CLECL1; C-type lectin-like 1; C-type lectin-like domain family 1; DCAL1; dendritic cell associated lectin 1; DCAL-1; DC-associated lectin-1; dendritic cell-associated lectin 1; dendritic cell-associated lectin-1; type II transmembrane protein DCAL1; |
| Gene ID | 160365 |
| mRNA Refseq | NM_001253748 |
| Protein Refseq | NP_001240677 |
| MIM | 607467 |
| UniProt ID | Q8IZS7 |
| ◆ Recombinant Proteins | ||
| CLECL1-2383H | Recombinant Human CLECL1 protein, His & Myc-tagged | +Inquiry |
| CLECL1-2382H | Recombinant Human CLECL1 Protein, GST-tagged | +Inquiry |
| CLECL1-02H | Recombinant Human CLECL1 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLECL1 Products
Required fields are marked with *
My Review for All CLECL1 Products
Required fields are marked with *
