Recombinant Human CLECL1 Protein, N-His tagged
Cat.No. : | CLECL1-02H |
Product Overview : | Recombinant Human CLECL1 Protein with N-His tag was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a type II transmembrane, C-type lectin-like protein that is highly expressed on dendritic and B cells. This protein may act as a T-cell costimulatory molecule that enhances interleukin-4 production, and maybe involved in the regulation of the immune response. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | The protein has a calculated MW of 11 kDa. |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.1 mg/mL by BCA |
Storage Buffer : | Sterile 20 mM Tris, 150 mM NaCl, 0.5M Argine, 10% Glycerol, pH8.5 |
Gene Name | CLECL1 C-type lectin-like 1 [ Homo sapiens ] |
Official Symbol | CLECL1 |
Synonyms | CLECL1; C-type lectin-like 1; C-type lectin-like domain family 1; DCAL1; dendritic cell associated lectin 1; DCAL-1; DC-associated lectin-1; dendritic cell-associated lectin 1; dendritic cell-associated lectin-1; type II transmembrane protein DCAL1; |
Gene ID | 160365 |
mRNA Refseq | NM_001253748 |
Protein Refseq | NP_001240677 |
MIM | 607467 |
UniProt ID | Q8IZS7 |
◆ Recombinant Proteins | ||
CLECL1-02H | Recombinant Human CLECL1 Protein, N-His tagged | +Inquiry |
CLECL1-2383H | Recombinant Human CLECL1 protein, His & Myc-tagged | +Inquiry |
CLECL1-2382H | Recombinant Human CLECL1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLECL1 Products
Required fields are marked with *
My Review for All CLECL1 Products
Required fields are marked with *
0
Inquiry Basket