Recombinant Human CLECL1 Protein, His tagged
| Cat.No. : | CLECL1-02H |
| Product Overview : | Recombinant Human CLECL1 Protein with His tag was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 89-167 aa |
| Description : | This gene encodes a type II transmembrane, C-type lectin-like protein that is highly expressed on dendritic and B cells. This protein may act as a T-cell costimulatory molecule that enhances interleukin-4 production, and maybe involved in the regulation of the immune response. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| AASequence : | MGSSHHHHHHSSGLVPRGSHMKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI |
| Molecular Mass : | 11 kDa |
| Endotoxin : | < 1 EU/μg by LAL. |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile 20mM Tris, 150mM NaCl, 0.5M Arginine, 10% Glycerol, pH8.5 |
| Concentration : | 0.38 mg/mL by BCA |
| Gene Name | CLECL1P C-type lectin like 1, pseudogene [ Homo sapiens (human) ] |
| Official Symbol | CLECL1 |
| Synonyms | CLECL1; C-type lectin-like 1; C-type lectin-like domain family 1; DCAL1; dendritic cell associated lectin 1; DCAL-1; DC-associated lectin-1; dendritic cell-associated lectin 1; dendritic cell-associated lectin-1; type II transmembrane protein DCAL1; |
| Gene ID | 160365 |
| mRNA Refseq | NM_001253748 |
| Protein Refseq | NP_001240677 |
| MIM | 607467 |
| UniProt ID | Q8IZS7 |
| ◆ Recombinant Proteins | ||
| CLECL1-2382H | Recombinant Human CLECL1 Protein, GST-tagged | +Inquiry |
| CLECL1-2383H | Recombinant Human CLECL1 protein, His & Myc-tagged | +Inquiry |
| CLECL1-02H | Recombinant Human CLECL1 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLECL1 Products
Required fields are marked with *
My Review for All CLECL1 Products
Required fields are marked with *
