Recombinant Human CLECL1 Protein, His tagged

Cat.No. : CLECL1-02H
Product Overview : Recombinant Human CLECL1 Protein with His tag was expressed in E. coli.
Availability December 17, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 89-167 aa
Description : This gene encodes a type II transmembrane, C-type lectin-like protein that is highly expressed on dendritic and B cells. This protein may act as a T-cell costimulatory molecule that enhances interleukin-4 production, and maybe involved in the regulation of the immune response. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
AASequence : MGSSHHHHHHSSGLVPRGSHMKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI
Molecular Mass : 11 kDa
Endotoxin : < 1 EU/μg by LAL.
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile 20mM Tris, 150mM NaCl, 0.5M Arginine, 10% Glycerol, pH8.5
Concentration : 0.38 mg/mL by BCA
Gene Name CLECL1P C-type lectin like 1, pseudogene [ Homo sapiens (human) ]
Official Symbol CLECL1
Synonyms CLECL1; C-type lectin-like 1; C-type lectin-like domain family 1; DCAL1; dendritic cell associated lectin 1; DCAL-1; DC-associated lectin-1; dendritic cell-associated lectin 1; dendritic cell-associated lectin-1; type II transmembrane protein DCAL1;
Gene ID 160365
mRNA Refseq NM_001253748
Protein Refseq NP_001240677
MIM 607467
UniProt ID Q8IZS7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLECL1 Products

Required fields are marked with *

My Review for All CLECL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon