Recombinant Human CLIC1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CLIC1-5937H |
Product Overview : | CLIC1 MS Standard C13 and N15-labeled recombinant protein (NP_001279) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. |
Molecular Mass : | 26.7 kDa |
AA Sequence : | MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CLIC1 chloride intracellular channel 1 [ Homo sapiens (human) ] |
Official Symbol | CLIC1 |
Synonyms | CLIC1; chloride intracellular channel 1; chloride intracellular channel protein 1; NCC27; p64CLCP; hRNCC; RNCC protein; chloride channel ABP; nuclear chloride ion channel 27; nuclear chloride ion channel protein; regulatory nuclear chloride ion channel protein; G6; |
Gene ID | 1192 |
mRNA Refseq | NM_001288 |
Protein Refseq | NP_001279 |
MIM | 602872 |
UniProt ID | O00299 |
◆ Recombinant Proteins | ||
CLIC1-1448R | Recombinant Rat CLIC1 Protein | +Inquiry |
CLIC1-5937H | Recombinant Human CLIC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CLIC1-11958Z | Recombinant Zebrafish CLIC1 | +Inquiry |
RFL17585SF | Recombinant Full Length Pig Chloride Intracellular Channel Protein 1(Clic1) Protein, His-Tagged | +Inquiry |
RFL30084OF | Recombinant Full Length Rabbit Chloride Intracellular Channel Protein 1(Clic1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLIC1-7448HCL | Recombinant Human CLIC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLIC1 Products
Required fields are marked with *
My Review for All CLIC1 Products
Required fields are marked with *
0
Inquiry Basket