Recombinant Human CLIC3 protein, T7-tagged
| Cat.No. : | CLIC3-155H |
| Product Overview : | Recombinant human CLIC3 (236 aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Protein Length : | 236 a.a. |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGEFMAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGS QLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRAL ARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAM QEKEFKYTCPHSAEILAAYRPAVHPR |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | CLIC3 chloride intracellular channel 3 [ Homo sapiens ] |
| Official Symbol | CLIC3 |
| Synonyms | CLIC3; chloride intracellular channel 3; chloride intracellular channel protein 3; |
| Gene ID | 9022 |
| mRNA Refseq | NM_004669 |
| Protein Refseq | NP_004660 |
| MIM | 606533 |
| UniProt ID | O95833 |
| Chromosome Location | 9q34.3 |
| Function | chloride channel activity; protein binding; voltage-gated chloride channel activity; voltage-gated ion channel activity; |
| ◆ Recombinant Proteins | ||
| CLIC3-3259H | Recombinant Human CLIC3 Protein, MYC/DDK-tagged | +Inquiry |
| CLIC3-1479H | Recombinant Human CLIC3 Protein, GST-tagged | +Inquiry |
| CLIC3-2265H | Recombinant Human CLIC3 Protein (Met1-Arg236), C-His tagged | +Inquiry |
| CLIC3-155H | Recombinant Human CLIC3 protein, T7-tagged | +Inquiry |
| RFL12342MF | Recombinant Full Length Mouse Chloride Intracellular Channel Protein 3(Clic3) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLIC3-364HCL | Recombinant Human CLIC3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLIC3 Products
Required fields are marked with *
My Review for All CLIC3 Products
Required fields are marked with *
