Recombinant Human CLTCL1 Protein (1423-1566 aa), His-tagged

Cat.No. : CLTCL1-1363H
Product Overview : Recombinant Human CLTCL1 Protein (1423-1566 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1423-1566 aa
Description : Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma mbrane or to the trans-Golgi network.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 18.8 kDa
AA Sequence : LLVLSPRLDHTWTVSFFSKAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNISLAQQLEKHQLMEFRCIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEEGKRECF
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name CLTCL1 clathrin, heavy chain-like 1 [ Homo sapiens ]
Official Symbol CLTCL1
Synonyms CLTD; CHC22; CLH22; CLTCL;
Gene ID 8218
mRNA Refseq NM_007098.3
Protein Refseq NP_009029.3
MIM 601273
UniProt ID P53675

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLTCL1 Products

Required fields are marked with *

My Review for All CLTCL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon