Recombinant Human CNN2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CNN2-3796H |
Product Overview : | CNN2 MS Standard C13 and N15-labeled recombinant protein (NP_004359) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Several pseudogenes of this gene have been identified, and are present on chromosomes 1, 2, 3, 6, 9, 11, 13, 15, 16, 21 and 22. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Molecular Mass : | 33.5 kDa |
AA Sequence : | MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CNN2 calponin 2 [ Homo sapiens (human) ] |
Official Symbol | CNN2 |
Synonyms | CNN2; calponin 2; calponin-2; neutral calponin; calponin H2, smooth muscle; |
Gene ID | 1265 |
mRNA Refseq | NM_004368 |
Protein Refseq | NP_004359 |
MIM | 602373 |
UniProt ID | Q99439 |
◆ Recombinant Proteins | ||
CNN2-12529Z | Recombinant Zebrafish CNN2 | +Inquiry |
CNN2-1752H | Recombinant Human CNN2 Protein (Met1-Tyr269), N-His tagged | +Inquiry |
CNN2-3796H | Recombinant Human CNN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CNN2-628H | Recombinant Human CNN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNN2-1929HF | Recombinant Full Length Human CNN2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNN2-7405HCL | Recombinant Human CNN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNN2 Products
Required fields are marked with *
My Review for All CNN2 Products
Required fields are marked with *