Recombinant Human CNOT7 protein, GST-tagged

• Cat.No.: CNOT7-1793H
• Product Overview: Recombinant Human CNOT7 protein(1-285 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-285 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: CNOT7 CCR4-NOT transcription complex, subunit 7 [ Homo sapiens ]
• Official Symbol: CNOT7
• Synonyms: CNOT7; CCR4-NOT transcription complex, subunit 7; CAF1; CCR4-NOT transcription complex subunit 7; BTG1 binding factor 1; CAF-1; BTG1-binding factor 1; CCR4-associated factor 1; carbon catabolite repressor protein (CCR4)-associative factor 1; hCAF-1
• Gene ID: 29883
• mRNA Refseq: NM_013354
• Protein Refseq: NP_037486
• MIM: 604913
• UniProt ID: Q9UIV1