Recombinant Human CNOT7 protein, GST-tagged
| Cat.No. : | CNOT7-1793H |
| Product Overview : | Recombinant Human CNOT7 protein(1-285 aa), fused to GST tag, was expressed in E. coli. |
| Availability | January 15, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-285 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CNOT7 CCR4-NOT transcription complex, subunit 7 [ Homo sapiens ] |
| Official Symbol | CNOT7 |
| Synonyms | CNOT7; CCR4-NOT transcription complex, subunit 7; CAF1; CCR4-NOT transcription complex subunit 7; BTG1 binding factor 1; CAF-1; BTG1-binding factor 1; CCR4-associated factor 1; carbon catabolite repressor protein (CCR4)-associative factor 1; hCAF-1; |
| Gene ID | 29883 |
| mRNA Refseq | NM_013354 |
| Protein Refseq | NP_037486 |
| MIM | 604913 |
| UniProt ID | Q9UIV1 |
| ◆ Recombinant Proteins | ||
| CNOT7-4644Z | Recombinant Zebrafish CNOT7 | +Inquiry |
| Cnot7-7306M | Recombinant Mouse Cnot7 Protein, His-tagged | +Inquiry |
| Cnot7-3640R | Recombinant Mouse Cnot7, His-tagged | +Inquiry |
| CNOT7-1594C | Recombinant Chicken CNOT7 | +Inquiry |
| CNOT7-766R | Recombinant Rhesus Macaque CNOT7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CNOT7-7399HCL | Recombinant Human CNOT7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNOT7 Products
Required fields are marked with *
My Review for All CNOT7 Products
Required fields are marked with *
