Recombinant Human CNOT7 protein, GST-tagged

Cat.No. : CNOT7-1793H
Product Overview : Recombinant Human CNOT7 protein(1-285 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability June 16, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-285 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AASequence : MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name CNOT7 CCR4-NOT transcription complex, subunit 7 [ Homo sapiens ]
Official Symbol CNOT7
Synonyms CNOT7; CCR4-NOT transcription complex, subunit 7; CAF1; CCR4-NOT transcription complex subunit 7; BTG1 binding factor 1; CAF-1; BTG1-binding factor 1; CCR4-associated factor 1; carbon catabolite repressor protein (CCR4)-associative factor 1; hCAF-1;
Gene ID 29883
mRNA Refseq NM_013354
Protein Refseq NP_037486
MIM 604913
UniProt ID Q9UIV1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CNOT7 Products

Required fields are marked with *

My Review for All CNOT7 Products

Required fields are marked with *

0
cart-icon
0
compare icon